A0A0M3MIT1 · A0A0M3MIT1_9NEOP
- ProteinCytochrome c oxidase subunit 1
- GeneCOI
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids194 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Catalytic activity
- 4 Fe(II)-[cytochrome c] + 8 H+(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H+(out) + 2 H2OThis reaction proceeds in the forward direction.
4 RHEA-COMP:10350 + 8 H+ (in)CHEBI:15378+ CHEBI:15379 = 4 RHEA-COMP:14399 + 4 H+ (out)CHEBI:15378+ 2 CHEBI:15377
Cofactor
Pathway
Energy metabolism; oxidative phosphorylation.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respirasome | |
Molecular Function | cytochrome-c oxidase activity | |
Molecular Function | heme binding | |
Molecular Function | metal ion binding | |
Biological Process | oxidative phosphorylation |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome c oxidase subunit 1
- EC number
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Paraneoptera > Thysanoptera > Terebrantia > Thripoidea > Thripidae > Thrips
Accessions
- Primary accessionA0A0M3MIT1
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 6-25 | Helical | ||||
Sequence: FGFWSGMMGLSLSMIIRLNL | ||||||
Transmembrane | 37-59 | Helical | ||||
Sequence: FYNSIVTAHAFVMIFFTVMPIMI | ||||||
Transmembrane | 132-153 | Helical | ||||
Sequence: LHLAGISSILGALNFITTIINL | ||||||
Transmembrane | 165-192 | Helical | ||||
Sequence: LFVWSVILTAILLLLSLPVLAGAITMLL |
Keywords
- Cellular component
Interaction
Subunit
Component of the cytochrome c oxidase (complex IV, CIV), a multisubunit enzyme composed of a catalytic core of 3 subunits and several supernumerary subunits. The complex exists as a monomer or a dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-194 | Cytochrome oxidase subunit I profile | ||||
Sequence: ILYFIFGFWSGMMGLSLSMIIRLNLRTMKLFISNDQFYNSIVTAHAFVMIFFTVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLGLLIMGLYKEGAGTGWTVYPPLSTFYHSGPSVDLTIFSLHLAGISSILGALNFITTIINLKAKNLSAEKISLFVWSVILTAILLLLSLPVLAGAITMLLTD |
Sequence similarities
Belongs to the heme-copper respiratory oxidase family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length194
- Mass (Da)21,375
- Last updated2015-12-09 v1
- Checksum7941AB0F26EA9943
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: I | ||||||
Non-terminal residue | 194 | |||||
Sequence: D |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KM529304 EMBL· GenBank· DDBJ | AKH51253.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM532338 EMBL· GenBank· DDBJ | AKH54285.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM536980 EMBL· GenBank· DDBJ | AKH58927.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KR145988 EMBL· GenBank· DDBJ | ALT31368.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG357037 EMBL· GenBank· DDBJ | AYK47124.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG357432 EMBL· GenBank· DDBJ | AYK47519.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358200 EMBL· GenBank· DDBJ | AYK48287.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358433 EMBL· GenBank· DDBJ | AYK48520.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358513 EMBL· GenBank· DDBJ | AYK48600.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358806 EMBL· GenBank· DDBJ | AYK48893.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358835 EMBL· GenBank· DDBJ | AYK48922.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG358931 EMBL· GenBank· DDBJ | AYK49018.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG359256 EMBL· GenBank· DDBJ | AYK49343.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG359508 EMBL· GenBank· DDBJ | AYK49595.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG359654 EMBL· GenBank· DDBJ | AYK49741.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG359941 EMBL· GenBank· DDBJ | AYK50028.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG360034 EMBL· GenBank· DDBJ | AYK50121.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG360151 EMBL· GenBank· DDBJ | AYK50238.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG360235 EMBL· GenBank· DDBJ | AYK50322.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG360946 EMBL· GenBank· DDBJ | AYK51033.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG361083 EMBL· GenBank· DDBJ | AYK51170.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG361308 EMBL· GenBank· DDBJ | AYK51395.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG361421 EMBL· GenBank· DDBJ | AYK51508.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG361957 EMBL· GenBank· DDBJ | AYK52044.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG363087 EMBL· GenBank· DDBJ | AYK53174.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG363096 EMBL· GenBank· DDBJ | AYK53183.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG363909 EMBL· GenBank· DDBJ | AYK53996.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MG365299 EMBL· GenBank· DDBJ | AYK55386.1 EMBL· GenBank· DDBJ | Genomic DNA |