A0A0M2UPQ1 · A0A0M2UPQ1_9BACT
- ProteinDNA ligase
- GeneligA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids671 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.
Catalytic activity
Cofactor
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 32-36 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: DYEYD | ||||||
Binding site | 81-82 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: SI | ||||||
Binding site | 115 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Active site | 117 | N6-AMP-lysine intermediate | ||||
Sequence: K | ||||||
Binding site | 138 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 179 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 295 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 319 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 413 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 416 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 429 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 434 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | DNA binding | |
Molecular Function | DNA ligase (NAD+) activity | |
Molecular Function | metal ion binding | |
Biological Process | base-excision repair, DNA ligation | |
Biological Process | DNA replication |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA ligase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Planctomycetota > Candidatus Brocadiia > Candidatus Brocadiales > Candidatus Brocadiaceae > Candidatus Brocadia
Accessions
- Primary accessionA0A0M2UPQ1
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 594-671 | BRCT | ||||
Sequence: EKNPKISGKSFIITGTLQKHSRKEAEMLIKQQGGRIVSQVSKKTNYLVVGEDPGSKLDKARELDVAILDEETFEKMIR |
Sequence similarities
Belongs to the NAD-dependent DNA ligase family. LigA subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length671
- Mass (Da)75,879
- Last updated2015-11-11 v1
- ChecksumC6DEFA4E8213C108
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LAQJ01000294 EMBL· GenBank· DDBJ | KKO18093.1 EMBL· GenBank· DDBJ | Genomic DNA |