A0A0L8G698 · A0A0L8G698_OCTBM
- ProteinPeptidase M20 dimerisation domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids316 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
Catalytic activity
- (5Z,8Z,11Z,14Z)-eicosatetraenoate + L-phenylalanine = H2O + N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-L-phenylalanineThis reaction proceeds in the forward and the backward directions.
- (9Z)-octadecenoate + L-phenylalanine = H2O + N-(9Z-octadecenoyl)-L-phenylalanineThis reaction proceeds in the forward and the backward directions.
- (9Z)-octadecenoate + glycine = H2O + N-(9Z-octadecenoyl)glycineThis reaction proceeds in the backward direction.
- H2O + N-(4Z,7Z,10Z,13Z,16Z,19Z-docosahexaenoyl)-L-phenylalanine = (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + L-phenylalanineThis reaction proceeds in the forward direction.
- H2O + N-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-glycine = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycineThis reaction proceeds in the forward and the backward directions.
- H2O + N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-L-serine = (5Z,8Z,11Z,14Z)-eicosatetraenoate + L-serineThis reaction proceeds in the forward and the backward directions.
- H2O + N-(9Z-octadecenoyl)-L-asparagine = (9Z)-octadecenoate + L-asparagineThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-glutamine = (9Z)-octadecenoate + L-glutamineThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-leucine = (9Z)-octadecenoate + L-leucineThis reaction proceeds in the forward and the backward directions.
- H2O + N-(9Z-octadecenoyl)-L-lysine = (9Z)-octadecenoate + L-lysineThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-methionine = (9Z)-octadecenoate + L-methionineThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-serine = (9Z)-octadecenoate + L-serineThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-tryptophan = (9Z)-octadecenoate + L-tryptophanThis reaction proceeds in the forward direction.
- H2O + N-(9Z-octadecenoyl)-L-tyrosine = (9Z)-octadecenoate + L-tyrosineThis reaction proceeds in the forward direction.
- H2O + N-hexadecanoyl-L-phenylalanine = hexadecanoate + L-phenylalanineThis reaction proceeds in the forward direction.
- H2O + N-octadecanoyl-L-phenylalanine = L-phenylalanine + octadecanoateThis reaction proceeds in the forward direction.
Pathway
Lipid metabolism; fatty acid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | |
Molecular Function | metal ion binding | |
Molecular Function | peptidase activity | |
Biological Process | amide biosynthetic process | |
Biological Process | amide catabolic process | |
Biological Process | amino acid metabolic process | |
Biological Process | cellular lipid metabolic process | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended namePeptidase M20 dimerisation domain-containing protein
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Mollusca > Cephalopoda > Coleoidea > Octopodiformes > Octopoda > Incirrata > Octopodidae > Octopus
Accessions
- Primary accessionA0A0L8G698
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 184-316 | Peptidase M20 dimerisation | ||||
Sequence: EKGQAIVKLSVNGTAGHSAIPPPESVIGILSTAIRRIESNPQPDLFGTGAERAMFEHLAPKLPFLPRMVLSNLWLFRPVVSWVLSRQPQTNALIRTVNAVTKFNAGIKDNVLSDSAEAVIDYRIHPSQTLEQV |
Sequence similarities
Belongs to the peptidase M20A family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length316
- Mass (Da)35,399
- Last updated2015-11-11 v1
- ChecksumA65F698030412A5F