A0A0L1KB91 · A0A0L1KB91_9SPHN
- ProteinAspartate-semialdehyde dehydrogenase
- Geneasd
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids341 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.
Catalytic activity
- L-aspartate 4-semialdehyde + phosphate + NADP+ = 4-phospho-L-aspartate + NADPH + H+
Pathway
Amino-acid biosynthesis; L-lysine biosynthesis via DAP pathway; (S)-tetrahydrodipicolinate from L-aspartate: step 2/4.
Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homoserine from L-aspartate: step 2/3.
Amino-acid biosynthesis; L-threonine biosynthesis; L-threonine from L-aspartate: step 2/5.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11-14 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: TGNV | ||||||
Binding site | 39-40 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: RS | ||||||
Binding site | 101 | phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Active site | 132 | Acyl-thioester intermediate | ||||
Sequence: C | ||||||
Binding site | 159 | substrate | ||||
Sequence: Q | ||||||
Binding site | 162-163 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: SG | ||||||
Binding site | 237 | substrate | ||||
Sequence: R | ||||||
Active site | 244 | Proton acceptor | ||||
Sequence: H | ||||||
Binding site | 317 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | aspartate-semialdehyde dehydrogenase activity | |
Molecular Function | NAD binding | |
Molecular Function | NADP binding | |
Molecular Function | protein dimerization activity | |
Biological Process | 'de novo' L-methionine biosynthetic process | |
Biological Process | diaminopimelate biosynthetic process | |
Biological Process | isoleucine biosynthetic process | |
Biological Process | lysine biosynthetic process via diaminopimelate | |
Biological Process | threonine biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAspartate-semialdehyde dehydrogenase
- EC number
- Short namesASA dehydrogenase ; ASADH
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Sphingomonadales > Erythrobacteraceae > Qipengyuania
Accessions
- Primary accessionA0A0L1KB91
Proteomes
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-121 | Semialdehyde dehydrogenase NAD-binding | ||||
Sequence: RVAVVGATGNVGREMMQVLAERGFPCDEVAAVASSRSQGTEVEFGDTGKMLKCKNIEHFDWAGWDIALFSAGSGPAKEYAPKAAAAGCVVIDNSSLYRMDPDVPLIVPEVNPEAIHDY |
Sequence similarities
Belongs to the aspartate-semialdehyde dehydrogenase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length341
- Mass (Da)36,973
- Last updated2015-11-11 v1
- Checksum674C0C8A834C77E7
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JYNE01000027 EMBL· GenBank· DDBJ | KNH01144.1 EMBL· GenBank· DDBJ | Genomic DNA |