A0A0K2U6X7 · A0A0K2U6X7_LEPSM
- ProteinE3 ubiquitin-protein ligase parkin
- GeneDsec\GM22162
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids452 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 419 | |||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | Golgi apparatus | |
Cellular Component | mitochondrion | |
Cellular Component | ubiquitin ligase complex | |
Molecular Function | ubiquitin conjugating enzyme binding | |
Molecular Function | ubiquitin protein ligase activity | |
Molecular Function | zinc ion binding | |
Biological Process | autophagy of mitochondrion | |
Biological Process | negative regulation of protein phosphorylation | |
Biological Process | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | |
Biological Process | protein polyubiquitination | |
Biological Process | regulation of apoptotic process | |
Biological Process | regulation of cellular response to oxidative stress | |
Biological Process | regulation of mitochondrion organization | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase parkin
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Crustacea > Multicrustacea > Hexanauplia > Copepoda > Siphonostomatoida > Caligidae > Lepeophtheirus
Accessions
- Primary accessionA0A0K2U6X7
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MAFFSWLWQSLLYLLG | ||||||
Chain | PRO_5005488403 | 17-452 | E3 ubiquitin-protein ligase parkin | |||
Sequence: YEVERDARDPSSIKIYLRTNNSSRIPLVINKDDDLTIGDLKARGILPSSDHEIIFQGRVLSDDVVLLRDCDLGNQTVIDTVRKKNSDPKKSSQNAPKTLTTLQLNSEDRGSSRSNGIFFVYCKECASLKHAKLRVRCSNCESGAIILFSDPCSWDDVLHAAKISGSCQSCDSSNVPAKFYFKCVENFHKMESIYPPLYLIKSNSRDVPCLSCGEVENPVIVFECIDRHVLCIGCFQLYSISNLNERSFLLDEENGYSLGCPLKCGHDSLIKETKHFHLLGNDQYERYMRFAAEEFVLKNGGVLCPRPNCGMGIMVKPDIRKVTCNLPEGCGFSFCKNCLNGYHISSECPAVGENDQMTCVTTLPIHDSDRARWDNSQNTLMAIQNITKPCPSCRTPTERSGGCMHMICTRAGCGFEWCWMCQDIWSRSCMGDHWFG |
Keywords
- PTM
Interaction
Subunit
Forms an E3 ubiquitin ligase complex.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 29-103 | Ubiquitin-like | ||||
Sequence: IKIYLRTNNSSRIPLVINKDDDLTIGDLKARGILPSSDHEIIFQGRVLSDDVVLLRDCDLGNQTVIDTVRKKNSD | ||||||
Region | 99-127 | Disordered | ||||
Sequence: KKNSDPKKSSQNAPKTLTTLQLNSEDRGS | ||||||
Compositional bias | 107-127 | Polar residues | ||||
Sequence: SSQNAPKTLTTLQLNSEDRGS | ||||||
Domain | 221-452 | RING-type | ||||
Sequence: RDVPCLSCGEVENPVIVFECIDRHVLCIGCFQLYSISNLNERSFLLDEENGYSLGCPLKCGHDSLIKETKHFHLLGNDQYERYMRFAAEEFVLKNGGVLCPRPNCGMGIMVKPDIRKVTCNLPEGCGFSFCKNCLNGYHISSECPAVGENDQMTCVTTLPIHDSDRARWDNSQNTLMAIQNITKPCPSCRTPTERSGGCMHMICTRAGCGFEWCWMCQDIWSRSCMGDHWFG |
Sequence similarities
Belongs to the RBR family. Parkin subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length452
- Mass (Da)50,915
- Last updated2015-11-11 v1
- Checksum30BEE9A475B8F2D7
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 107-127 | Polar residues | ||||
Sequence: SSQNAPKTLTTLQLNSEDRGS |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HACA01016653 EMBL· GenBank· DDBJ | CDW34014.1 EMBL· GenBank· DDBJ | Transcribed RNA |