A0A0K0MJ13 · FABP5_PYGPA
- ProteinFatty acid-binding protein 5
- GeneFABP5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids134 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Intracellular carrier for long-chain fatty acids and related active lipids, such as endocannabinoids, that regulate the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (By similarity).
Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity).
Has the highest binding affinity for docosahexaenoic acid (DHA) and decreasing relative affinity for eicosapentaenoic acid (EPA), alpha-linolenic acid (ALA), oleic acid, palmitic acid, linoleic acid and stearic acid, respectively (PubMed:26206084).
Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity).
Has the highest binding affinity for docosahexaenoic acid (DHA) and decreasing relative affinity for eicosapentaenoic acid (EPA), alpha-linolenic acid (ALA), oleic acid, palmitic acid, linoleic acid and stearic acid, respectively (PubMed:26206084).
Catalytic activity
- hexadecanoate(out) = hexadecanoate(in)
- (9Z,12Z)-octadecadienoate(out) = (9Z,12Z)-octadecadienoate(in)
- (9Z)-octadecenoate(out) = (9Z)-octadecenoate(in)
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 109 | hexadecanoate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 109 | N-eicosanoyl ethanolamine (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 129-131 | (9Z,12Z)-octadecadienoate (UniProtKB | ChEBI) | ||||
Sequence: RVY | ||||||
Binding site | 129-131 | hexadecanoate (UniProtKB | ChEBI) | ||||
Sequence: RVY | ||||||
Binding site | 131 | N-eicosanoyl ethanolamine (UniProtKB | ChEBI) | ||||
Sequence: Y |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular region | |
Cellular Component | nucleus | |
Cellular Component | postsynaptic density | |
Molecular Function | lipid binding | |
Biological Process | lipid transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameFatty acid-binding protein 5
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Sphenisciformes > Spheniscidae > Pygoscelis
Accessions
- Primary accessionA0A0K0MJ13
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes primarily to the cytoplasm. Upon certain ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into nucleus (By similarity).
Secreted by astrocytes, but not by neurons (By similarity).
Secreted by astrocytes, but not by neurons (By similarity).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444561 | 1-134 | Fatty acid-binding protein 5 | |||
Sequence: MAIDAFLGKWCLISSEGFDEYMKELGVGMAMRKMGSMAKPDVYIIKDGDTITVKTESTFKTSQFSFKLGEKFEENTLDGRKTQTLVSLKDDGSLIQEQEWDGKKTIITRKLVDGQLVVECDMNGIKCVRVYQKA |
Interaction
Subunit
Monomer.
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 23-33 | Nuclear localization signal | ||||
Sequence: KELGVGMAMRK |
Domain
Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Sequence similarities
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length134
- Mass (Da)15,107
- Last updated2015-11-11 v1
- Checksum08503ED1EDBB161E
Keywords
- Technical term