A0A0I9Z1U6 · A0A0I9Z1U6_9MYCO
- ProteinRiboflavin biosynthesis protein RibBA
- GeneribBA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids425 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate.
Catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (DARP), formate and pyrophosphate.
Catalytic activity
- D-ribulose 5-phosphate = (2S)-2-hydroxy-3-oxobutyl phosphate + formate + H+
Cofactor
Protein has several cofactor binding sites:
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Note: Binds 2 divalent metal cations per subunit. Magnesium or manganese.
Note: Binds 1 zinc ion per subunit.
Pathway
Cofactor biosynthesis; riboflavin biosynthesis; 2-hydroxy-3-oxobutyl phosphate from D-ribulose 5-phosphate: step 1/1.
Cofactor biosynthesis; riboflavin biosynthesis; 5-amino-6-(D-ribitylamino)uracil from GTP: step 1/4.
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 28-29 | D-ribulose 5-phosphate (UniProtKB | ChEBI) | ||||
Sequence: RE | ||||||
Binding site | 29 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 29 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 33 | D-ribulose 5-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Site | 127 | Essential for DHBP synthase activity | ||||
Sequence: H | ||||||
Binding site | 141-145 | D-ribulose 5-phosphate (UniProtKB | ChEBI) | ||||
Sequence: RPGHT | ||||||
Binding site | 144 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 165 | D-ribulose 5-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Site | 165 | Essential for DHBP synthase activity | ||||
Sequence: E | ||||||
Binding site | 259-263 | GTP (UniProtKB | ChEBI) | ||||
Sequence: RVHSE | ||||||
Binding site | 264 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: C | ||||||
Binding site | 275 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: C | ||||||
Binding site | 277 | Zn2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: C | ||||||
Binding site | 280 | GTP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 303-305 | GTP (UniProtKB | ChEBI) | ||||
Sequence: EGR | ||||||
Binding site | 325 | GTP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Active site | 337 | Proton acceptor; for GTP cyclohydrolase activity | ||||
Sequence: D | ||||||
Active site | 339 | Nucleophile; for GTP cyclohydrolase activity | ||||
Sequence: R | ||||||
Binding site | 360 | GTP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 365 | GTP (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | 3,4-dihydroxy-2-butanone-4-phosphate synthase activity | |
Molecular Function | GTP binding | |
Molecular Function | GTP cyclohydrolase II activity | |
Molecular Function | magnesium ion binding | |
Molecular Function | manganese ion binding | |
Molecular Function | zinc ion binding | |
Biological Process | riboflavin biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRiboflavin biosynthesis protein RibBA
Including 2 domains:
- Recommended name3,4-dihydroxy-2-butanone 4-phosphate synthase
- EC number
- Short namesDHBP synthase
- Recommended nameGTP cyclohydrolase-2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Mycobacteriales > Mycobacteriaceae > Mycobacterium
Accessions
- Primary accessionA0A0I9Z1U6
Proteomes
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-204 | DHBP synthase | ||||
Sequence: MTRLDSVERAVTDIAAGKAVVVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDGAICDRLGLLPMFAVNQDKHGTAYTVTVDARNGVGTGISASDRATTMRLLADPASVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARLAGLQPAGAICEIVSQKDEGSMAQTDELRVFADEHDLALITIADLIEWRRK | ||||||
Region | 205-425 | GTP cyclohydrolase II | ||||
Sequence: HEKHIERVAEARIPTRHGEFRAIGYASIYEDVEHVALVRGEIAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGVVLYMRGHEGRGIGLMHKLQAYQLQDAGADTVDANLKLGFPADARDYGIGAQILVDLGVRSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANADNIRYLMTKRDKMGHDLAGLDDFHESAHLPGEFGGAL | ||||||
Domain | 210-381 | GTP cyclohydrolase II | ||||
Sequence: ERVAEARIPTRHGEFRAIGYASIYEDVEHVALVRGEIAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGVVLYMRGHEGRGIGLMHKLQAYQLQDAGADTVDANLKLGFPADARDYGIGAQILVDLGVRSMRLLTNNPAKRVGLDGYGLHIIERVP |
Sequence similarities
In the C-terminal section; belongs to the GTP cyclohydrolase II family.
In the N-terminal section; belongs to the DHBP synthase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length425
- Mass (Da)46,002
- Last updated2015-10-14 v1
- ChecksumFACBA58459A87BCD
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LDPR01000020 EMBL· GenBank· DDBJ | KLO34865.1 EMBL· GenBank· DDBJ | Genomic DNA |