A0A0H3HA88 · GSPI_KLEM8
- ProteinType II secretion system protein I
- GenepulI
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids121 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm (By similarity).
Part of the pseudopilus tip complex that is critical for the recognition and binding of secretion substrates (PubMed:22493189).
Part of the pseudopilus tip complex that is critical for the recognition and binding of secretion substrates (PubMed:22493189).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Cellular Component | type II protein secretion system complex | |
Biological Process | protein secretion by the type II secretion system |
Names & Taxonomy
Protein names
- Recommended nameType II secretion system protein I
- Short namesT2SS minor pseudopilin I
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Klebsiella/Raoultella group > Klebsiella
Accessions
- Primary accessionA0A0H3HA88
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 7-27 | Helical | ||||
Sequence: MTLLEVLVALAIFSLAGLTLL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Deletion mutant shows longer pili but their number is reduced.
PTM/Processing
Features
Showing features for propeptide, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000449547 | 1-6 | Leader sequence | |||
Sequence: MNKQKG | ||||||
Modified residue | 7 | N-methylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000449548 | 7-121 | Type II secretion system protein I | |||
Sequence: MTLLEVLVALAIFSLAGLTLLQTTAQQARNAGMMKEKMLASWLADNQQVRLHLNKLWPEKSATGALVTYAGEEWYLSWQGVDTEFSQLRALDIEVRRHKQDTAAIFSLRSYVVHE |
Post-translational modification
Cleaved by prepilin peptidase.
Methylated by prepilin peptidase at the amino group of the N-terminal methionine once the leader sequence is cleaved by prepilin peptidase.
Keywords
- PTM
Interaction
Subunit
Type II secretion is composed of four main components: the outer membrane complex, the inner membrane complex, the cytoplasmic secretion ATPase and the periplasm-spanning pseudopilus. Interacts with core component PulG (By similarity).
Interacts with pseudopilins PulJ and PulK (PubMed:22157749).
Interacts with pseudopilins PulJ and PulK (PubMed:22157749).
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length121
- Mass (Da)13,721
- Last updated2015-09-16 v1
- ChecksumBF5CA169F9B7E2E9
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP003218 EMBL· GenBank· DDBJ | AEX04442.1 EMBL· GenBank· DDBJ | Genomic DNA |