A0A0G2QC16 · A0A0G2QC16_RAT
- Proteinaldehyde oxidase
- GeneAox4
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1333 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Catalytic activity
- an aldehyde + H2O + O2 = a carboxylate + H+ + H2O2
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 Mo-molybdopterin (Mo-MPT) cofactor per subunit.
Note: Binds 2 [2Fe-2S] clusters.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 45 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 50 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 53 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 75 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 115 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 118 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 150 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 152 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 263-270 | FAD (UniProtKB | ChEBI) | ||||
Sequence: LVMGNTAV | ||||||
Binding site | 366 | FAD (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 428 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 771 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 802 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 916 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 918 | substrate | ||||
Sequence: F | ||||||
Binding site | 1083 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Active site | 1264 | Proton acceptor | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 2 iron, 2 sulfur cluster binding | |
Molecular Function | aldehyde oxidase activity | |
Molecular Function | FAD binding | |
Molecular Function | iron ion binding | |
Molecular Function | NAD binding |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namealdehyde oxidase
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionA0A0G2QC16
Proteomes
Organism-specific databases
Subcellular Location
Expression
Gene expression databases
Interaction
Subunit
Homodimer.
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-93 | 2Fe-2S ferredoxin-type | ||||
Sequence: DELIFFVNGKKVIEKNPVPEMNLLFYVRKVLHLTGTKYSCGGGGCGACTVMISRYNPESKKIYHYPATACLVPVCSLHGAAVTTVEGV | ||||||
Domain | 235-420 | FAD-binding PCMH-type | ||||
Sequence: FQGERTIWIMPVTLNDLLELKASYPEAPLVMGNTAVGPGMKFNNEFHPVFISPLGLPELNLVDTANSGVTIGARHSLAQMKDILHSLTLEQPKEKTKTHQALLKHLRTLAGPQIRNMATLGGHVVSRPDFSDLNPILAAGNATINVISKEGQRQIPLNGPFLERLPEASLKPEEVALSVFIPYSGQ |
Sequence similarities
Belongs to the xanthine dehydrogenase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,333
- Mass (Da)147,842
- Last updated2022-05-25 v2
- Checksum9A44D7F031AEFB1F
Computationally mapped potential isoform sequences
There are 10 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5QE79 | AOXD_RAT | Aox4 | 1334 | ||
A0A0G2K1Z5 | A0A0G2K1Z5_RAT | Aox3 | 1088 | ||
A0A8I6GM92 | A0A8I6GM92_RAT | Aox3 | 945 | ||
A0A8I6A9L1 | A0A8I6A9L1_RAT | Aox3 | 270 | ||
Q7TP79 | Q7TP79_RAT | Aox3 | 945 | ||
A0A8I5YBF0 | A0A8I5YBF0_RAT | Aox3 | 1280 | ||
A0A8I5ZJJ1 | A0A8I5ZJJ1_RAT | Aox3 | 1111 | ||
A0A1B0GWV6 | A0A1B0GWV6_RAT | Aox3 | 1334 | ||
A0A1B0GWM7 | A0A1B0GWM7_RAT | Aox4 | 1307 | ||
A0A8I5ZQJ3 | A0A8I5ZQJ3_RAT | Aox3 | 1384 |
Keywords
- Technical term