A0A0G2JQJ2 · A0A0G2JQJ2_HUMAN
- ProteinMucin 4, cell surface associated
- GeneMUC4
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1149 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Biological Process | cell-matrix adhesion |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A0G2JQJ2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1105-1131 | Helical | ||||
Sequence: AFFGIFFGALGGLLLLGVGTFVVLRFW |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,155 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | 884↔893 | |||||
Sequence: CPPAFTDSRC |
Keywords
- PTM
Proteomic databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: XMTTPSLKTDGGRRTATSPPPTTSQT | ||||||
Domain | 134-289 | NIDO | ||||
Sequence: PFWDDADFSTGRGTTFYQEYETFYGEHSLLVQQAESWIRKITNNGGYKARWALKVTWVNAHAYPAQWTLGSNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGKPVLMGFSSGDGYFENSPLMSQPVWERYRPDRFLNSNSGLQGLQFYRLHRE | ||||||
Domain | 290-405 | AMOP | ||||
Sequence: ERPNYRLECLQWLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQPVSIGRWGLGSRQLCSFTSWRGGVCCSYGPWGEFREGWHVQRPWQLAQELEPQSWCCRWNDKPYLCALYQQRR | ||||||
Domain | 417-617 | VWFD | ||||
Sequence: QPAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHSSASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLL | ||||||
Domain | 855-894 | EGF-like | ||||
Sequence: QNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCF | ||||||
Domain | 1058-1097 | EGF-like | ||||
Sequence: VSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCE |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length1,149
- Mass (Da)127,436
- Last updated2015-07-22 v1
- Checksum62CC96B1ED4B72B4
Computationally mapped potential isoform sequences
There are 55 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q99102 | MUC4_HUMAN | MUC4 | 5412 | ||
E7EW47 | E7EW47_HUMAN | MUC4 | 4400 | ||
E7EWN1 | E7EWN1_HUMAN | MUC4 | 5070 | ||
E7ETT5 | E7ETT5_HUMAN | MUC4 | 4510 | ||
E7EUL9 | E7EUL9_HUMAN | MUC4 | 4444 | ||
E7ERK0 | E7ERK0_HUMAN | MUC4 | 4442 | ||
E7EQG8 | E7EQG8_HUMAN | MUC4 | 4430 | ||
E7EQT2 | E7EQT2_HUMAN | MUC4 | 4458 | ||
H0Y2Y1 | H0Y2Y1_HUMAN | MUC4 | 144 | ||
A0A0G2JSB1 | A0A0G2JSB1_HUMAN | MUC4 | 1098 | ||
A0A0G2JSB4 | A0A0G2JSB4_HUMAN | MUC4 | 4416 | ||
A0A0G2JSC3 | A0A0G2JSC3_HUMAN | MUC4 | 1176 | ||
A0A0G2JSD9 | A0A0G2JSD9_HUMAN | MUC4 | 4418 | ||
A0A0G2JSE4 | A0A0G2JSE4_HUMAN | MUC4 | 167 | ||
A0A0G2JR43 | A0A0G2JR43_HUMAN | MUC4 | 4484 | ||
A0A0G2JR46 | A0A0G2JR46_HUMAN | MUC4 | 6436 | ||
A0A0G2JQN9 | A0A0G2JQN9_HUMAN | MUC4 | 4431 | ||
A0A0G2JR97 | A0A0G2JR97_HUMAN | MUC4 | 7366 | ||
A0A0G2JQT8 | A0A0G2JQT8_HUMAN | MUC4 | 5334 | ||
A0A0G2JR58 | A0A0G2JR58_HUMAN | MUC4 | 157 | ||
A0A0G2JQA9 | A0A0G2JQA9_HUMAN | MUC4 | 4393 | ||
A0A0G2JQC1 | A0A0G2JQC1_HUMAN | MUC4 | 1098 | ||
A0A0G2JQK9 | A0A0G2JQK9_HUMAN | MUC4 | 7076 | ||
A0A0G2JQI2 | A0A0G2JQI2_HUMAN | MUC4 | 6516 | ||
A0A0G2JQC6 | A0A0G2JQC6_HUMAN | MUC4 | 5044 | ||
A0A0G2JRT1 | A0A0G2JRT1_HUMAN | MUC4 | 5043 | ||
A0A0G2JRU8 | A0A0G2JRU8_HUMAN | MUC4 | 1125 | ||
A0A0G2JS65 | A0A0G2JS65_HUMAN | MUC4 | 7418 | ||
A0A0G2JRS2 | A0A0G2JRS2_HUMAN | MUC4 | 6406 | ||
A0A0G2JS19 | A0A0G2JS19_HUMAN | MUC4 | 4432 | ||
A0A0G2JS42 | A0A0G2JS42_HUMAN | MUC4 | 4403 | ||
A0A0G2JRV5 | A0A0G2JRV5_HUMAN | MUC4 | 4417 | ||
A0A0G2JRW3 | A0A0G2JRW3_HUMAN | MUC4 | 4373 | ||
A0A0G2JRW6 | A0A0G2JRW6_HUMAN | MUC4 | 4415 | ||
A0A0G2JRY3 | A0A0G2JRY3_HUMAN | MUC4 | 6450 | ||
A0A0G2JS91 | A0A0G2JS91_HUMAN | MUC4 | 4404 | ||
A0A0G2JRA1 | A0A0G2JRA1_HUMAN | MUC4 | 5386 | ||
A0A0G2JRC8 | A0A0G2JRC8_HUMAN | MUC4 | 137 | ||
A0A0G2JRD8 | A0A0G2JRD8_HUMAN | MUC4 | 6448 | ||
A0A0G2JRJ6 | A0A0G2JRJ6_HUMAN | MUC4 | 6464 | ||
A0A0G2JRE6 | A0A0G2JRE6_HUMAN | MUC4 | 4374 | ||
A0A0G2JRK4 | A0A0G2JRK4_HUMAN | MUC4 | 4483 | ||
A0A0G2JPA4 | A0A0G2JPA4_HUMAN | MUC4 | 2138 | ||
A0A0G2JLU8 | A0A0G2JLU8_HUMAN | MUC4 | 604 | ||
A0A0G2JNJ5 | A0A0G2JNJ5_HUMAN | MUC4 | 1149 | ||
A0A0G2JNL3 | A0A0G2JNL3_HUMAN | MUC4 | 2138 | ||
A0A0G2JNM3 | A0A0G2JNM3_HUMAN | MUC4 | 5385 | ||
A0A0G2JNG3 | A0A0G2JNG3_HUMAN | MUC4 | 609 | ||
A0A0G2JMX1 | A0A0G2JMX1_HUMAN | MUC4 | 5333 | ||
A0A0G2JN54 | A0A0G2JN54_HUMAN | MUC4 | 4969 | ||
H7BZI3 | H7BZI3_HUMAN | MUC4 | 164 | ||
H7BXN7 | H7BXN7_HUMAN | MUC4 | 174 | ||
E9PDY6 | E9PDY6_HUMAN | MUC4 | 5412 | ||
E7ENC5 | E7ENC5_HUMAN | MUC4 | 5360 | ||
A0A0G2JM16 | A0A0G2JM16_HUMAN | MUC4 | 5314 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: X |
Keywords
- Technical term