A0A0G2JNJ7 · A0A0G2JNJ7_HUMAN
- ProteinCCR4-NOT transcription complex subunit 3
- GeneCNOT3
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids375 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | CCR4-NOT core complex | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A0G2JNJ7
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 325 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 164 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 167 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 213 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 216 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 219 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 221 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-154 | CCR4-Not complex component Not N-terminal | ||||
Sequence: RKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDQKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLE | ||||||
Region | 157-375 | Disordered | ||||
Sequence: PQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQ | ||||||
Compositional bias | 162-201 | Polar residues | ||||
Sequence: ATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTT | ||||||
Compositional bias | 216-238 | Polar residues | ||||
Sequence: SEVSQSPAKNGSKPVHSNQHPQS | ||||||
Compositional bias | 295-312 | Pro residues | ||||
Sequence: QAVAPPAPSGPSTTQPRP | ||||||
Compositional bias | 325-375 | Polar residues | ||||
Sequence: SGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQ |
Sequence similarities
Belongs to the CNOT2/3/5 family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length375
- Mass (Da)39,477
- Last updated2018-06-20 v1
- ChecksumFF78D6C43DB71220
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O75175 | CNOT3_HUMAN | CNOT3 | 753 | ||
A0A2R8Y7Z8 | A0A2R8Y7Z8_HUMAN | CNOT3 | 194 | ||
A0A2R8Y6N5 | A0A2R8Y6N5_HUMAN | CNOT3 | 20 | ||
A0A2R8Y691 | A0A2R8Y691_HUMAN | CNOT3 | 156 | ||
A0A2R8Y4W0 | A0A2R8Y4W0_HUMAN | CNOT3 | 156 | ||
B7Z6J7 | B7Z6J7_HUMAN | CNOT3 | 718 | ||
H0Y5X7 | H0Y5X7_HUMAN | CNOT3 | 288 | ||
A0A2H2FJL5 | A0A2H2FJL5_HUMAN | CNOT3 | 571 | ||
A0A0G2JPP0 | A0A0G2JPP0_HUMAN | CNOT3 | 93 | ||
A0A0G2JN65 | A0A0G2JN65_HUMAN | CNOT3 | 96 | ||
H7C5J4 | H7C5J4_HUMAN | CNOT3 | 88 | ||
H7C148 | H7C148_HUMAN | CNOT3 | 455 | ||
A0A087X0F9 | A0A087X0F9_HUMAN | CNOT3 | 106 |
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: X | ||||||
Compositional bias | 162-201 | Polar residues | ||||
Sequence: ATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTT | ||||||
Compositional bias | 216-238 | Polar residues | ||||
Sequence: SEVSQSPAKNGSKPVHSNQHPQS | ||||||
Compositional bias | 295-312 | Pro residues | ||||
Sequence: QAVAPPAPSGPSTTQPRP | ||||||
Compositional bias | 325-375 | Polar residues | ||||
Sequence: SGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQ | ||||||
Non-terminal residue | 375 | |||||
Sequence: Q |
Keywords
- Technical term