A0A0E0GIZ1 · A0A0E0GIZ1_ORYNI
- ProteinReplication protein A subunit
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids630 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. The activity of RPA is mediated by single-stranded DNA binding and protein interactions. Probably involved in repair of double-strand DNA breaks (DSBs) induced by genotoxic stresses.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | DNA replication factor A complex | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | DNA replication |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameReplication protein A subunit
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza
Accessions
- Primary accessionA0A0E0GIZ1
Proteomes
Genome annotation databases
Subcellular Location
Interaction
Subunit
Heterotrimer of RPA1, RPA2 and RPA3 (canonical replication protein A complex).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-109 | Replication factor-A protein 1 N-terminal | ||||
Sequence: VTPGAVAFVLENASPDAATGVPVPEIVLQVVDLKPIGTRFTFLASDGKDKIKTMLLTQLAPEVRSGNIQNLGVIRVLDYTCNTIGEKQEKVLIITKLEVVF | ||||||
Domain | 200-280 | OB | ||||
Sequence: IIKVRVTSKGNLRTYKNARGEGCVFNVELTDVDGTQIQATMFNEAAKKFYPMFELGKVYYISKGSLRVANKQFKTVHNDYE | ||||||
Domain | 319-412 | Replication protein A OB | ||||
Sequence: ELVDVIGVVQSVSPTLSVRRKIDNETIPKRDIVVADDSSKTVTISLWNDLATTTGQELLDMVDSAPIIAIKSLKVSDFQGLSLSTVGRSTIVVN | ||||||
Domain | 475-620 | Replication factor A C-terminal | ||||
Sequence: FFSLNAYISLIKPDQTMWYRACKTCNKKVTEAIGSGYWCEGCQKNDAECSLRYIMVIKVSDPTGEAWLSLFNDQAERIVGCSADELDRIRKEEGDDSYLLKLKEATWVPHLFRVSVTQNEYMNEKRQRITVRSEAPVDHAAEAKYM |
Sequence similarities
Belongs to the replication factor A protein 1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length630
- Mass (Da)69,590
- Last updated2015-05-27 v1
- ChecksumC20008B9814820D0
Keywords
- Technical term