A0A0C4DGL1 · A0A0C4DGL1_HUMAN
- ProteinMannosidase alpha class 2A member 2
- GeneMAN2A2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids796 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | alpha-mannosidase activity | |
Molecular Function | carbohydrate binding | |
Biological Process | mannose metabolic process |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A0C4DGL1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 7-26 | Helical | ||||
Sequence: VTVCGAAIFCVAVFSLYLML |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 819 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 502-588 | Glycoside hydrolase family 38 central | ||||
Sequence: HYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRL |
Sequence similarities
Belongs to the glycosyl hydrolase 38 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length796
- Mass (Da)90,692
- Last updated2015-04-01 v1
- ChecksumD0FC8DDDB0A9BCA2
Computationally mapped potential isoform sequences
There are 14 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P49641 | MA2A2_HUMAN | MAN2A2 | 1150 | ||
H0YMU0 | H0YMU0_HUMAN | MAN2A2 | 72 | ||
H0YML7 | H0YML7_HUMAN | MAN2A2 | 58 | ||
H0YNG5 | H0YNG5_HUMAN | MAN2A2 | 938 | ||
H0YNC8 | H0YNC8_HUMAN | MAN2A2 | 76 | ||
H0YLU3 | H0YLU3_HUMAN | MAN2A2 | 319 | ||
H0YLL4 | H0YLL4_HUMAN | MAN2A2 | 164 | ||
H0YL67 | H0YL67_HUMAN | MAN2A2 | 120 | ||
H0YKM7 | H0YKM7_HUMAN | MAN2A2 | 329 | ||
H0YKQ2 | H0YKQ2_HUMAN | MAN2A2 | 195 | ||
H0YKT0 | H0YKT0_HUMAN | MAN2A2 | 264 | ||
H0YKH9 | H0YKH9_HUMAN | MAN2A2 | 360 | ||
H0YLB9 | H0YLB9_HUMAN | MAN2A2 | 793 | ||
H0YK77 | H0YK77_HUMAN | MAN2A2 | 50 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC067986 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC068831 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471101 EMBL· GenBank· DDBJ | EAX02123.1 EMBL· GenBank· DDBJ | Genomic DNA |