A0A0C4DG07 · A0A0C4DG07_HUMAN
- ProteinNibrin
- GeneNBN
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids672 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The MRN complex is involved in the repair of DNA double-strand breaks (DSBs) via homologous recombination (HR), an error-free mechanism which primarily occurs during S and G2 phases. The complex 1 mediates the end resection of damaged DNA, which generates proper single-stranded DNA, a key initial steps in HR, and is 2 required for the recruitment of other repair factors and efficient activation of ATM and ATR upon DNA damage. The MRN complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11, to initiate end resection, which is required for single-strand invasion and recombination. Within the MRN complex, nbn acts as a protein-protein adapter, which specifically recognizes and binds phosphorylated proteins, promoting their recruitment to DNA damage sites. Recruits mre11 and rad50 components of the MRN complex to DSBs in response to DNA damage. Promotes the recruitment of PI3/PI4-kinase family members atm, atr, and probably DNA-PKcs to the DNA damage sites, activating their functions. Mediates the recruitment of phosphorylated rbbp8/CtIP to DSBs, leading to cooperation between the MRN complex and rbbp8/CtIP to initiate end resection.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | Golgi apparatus | |
Cellular Component | Mre11 complex | |
Cellular Component | nucleoplasm | |
Biological Process | double-strand break repair | |
Biological Process | meiotic cell cycle | |
Biological Process | mitotic G2 DNA damage checkpoint signaling | |
Biological Process | telomere maintenance |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNibrin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A0C4DG07
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,878 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 255 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 259 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 261 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 265 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 315 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 329 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 347 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 350 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 352 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 365 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 403 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 415 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 427 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 436 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 520 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 522 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 529 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 533 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 656 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Component of the MRN complex.
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 244-262 | Polar residues | ||||
Sequence: QGHPSTGLKTTTPGPSLSQ | ||||||
Region | 244-264 | Disordered | ||||
Sequence: QGHPSTGLKTTTPGPSLSQGV | ||||||
Region | 314-333 | Disordered | ||||
Sequence: LSQDAPTVKESCKTSSNNNS | ||||||
Compositional bias | 348-378 | Polar residues | ||||
Sequence: QLSPTKLPSINKSKDRASQQQQTNSIRNYFQ | ||||||
Region | 348-396 | Disordered | ||||
Sequence: QLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSC | ||||||
Compositional bias | 379-395 | Basic and acidic residues | ||||
Sequence: PSTKKRERDEENQEMSS | ||||||
Domain | 600-664 | Nibrin C-terminal | ||||
Sequence: LKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRY |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length672
- Mass (Da)75,969
- Last updated2015-04-01 v1
- Checksum261AFBB31A0D3030
Computationally mapped potential isoform sequences
There are 20 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O60934 | NBN_HUMAN | NBN | 754 | ||
E2QRP0 | E2QRP0_HUMAN | NBN | 58 | ||
A0A8V8TM80 | A0A8V8TM80_HUMAN | NBN | 771 | ||
A0A8V8TM88 | A0A8V8TM88_HUMAN | NBN | 650 | ||
A0A8V8TM94 | A0A8V8TM94_HUMAN | NBN | 732 | ||
A0A8V8TMG0 | A0A8V8TMG0_HUMAN | NBN | 47 | ||
A0A8V8TMG6 | A0A8V8TMG6_HUMAN | NBN | 63 | ||
A0A8V8TMH1 | A0A8V8TMH1_HUMAN | NBN | 679 | ||
A0A8V8TMH6 | A0A8V8TMH6_HUMAN | NBN | 734 | ||
A0A8V8TKV9 | A0A8V8TKV9_HUMAN | NBN | 60 | ||
A0A8V8TKW6 | A0A8V8TKW6_HUMAN | NBN | 731 | ||
A0A8V8TKY0 | A0A8V8TKY0_HUMAN | NBN | 161 | ||
A0A8V8TL91 | A0A8V8TL91_HUMAN | NBN | 145 | ||
A0A8V8TL95 | A0A8V8TL95_HUMAN | NBN | 79 | ||
A0A8V8TL98 | A0A8V8TL98_HUMAN | NBN | 161 | ||
A0A8V8TKY5 | A0A8V8TKY5_HUMAN | NBN | 782 | ||
A0A8V8TLA3 | A0A8V8TLA3_HUMAN | NBN | 165 | ||
A0A087X1V5 | A0A087X1V5_HUMAN | NBN | 124 | ||
E5RGR7 | E5RGR7_HUMAN | NBN | 164 | ||
E5RGU1 | E5RGU1_HUMAN | NBN | 159 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 244-262 | Polar residues | ||||
Sequence: QGHPSTGLKTTTPGPSLSQ | ||||||
Compositional bias | 348-378 | Polar residues | ||||
Sequence: QLSPTKLPSINKSKDRASQQQQTNSIRNYFQ | ||||||
Compositional bias | 379-395 | Basic and acidic residues | ||||
Sequence: PSTKKRERDEENQEMSS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF069291 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF117829 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF495769 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471060 EMBL· GenBank· DDBJ | EAW91661.1 EMBL· GenBank· DDBJ | Genomic DNA |