A0A0B4K8A2 · A0A0B4K8A2_DROME
- ProteinSmooth, isoform AA
- Genesm
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids508 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | mRNA binding | |
Biological Process | adult feeding behavior | |
Biological Process | axon guidance | |
Biological Process | determination of adult lifespan | |
Biological Process | mRNA processing | |
Biological Process | regulation of RNA splicing |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionA0A0B4K8A2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-40 | Disordered | ||||
Sequence: MPYNGASNGSGASGAGGGGATIVVTEGPQNKKIRTGVQQP | ||||||
Domain | 76-153 | RRM | ||||
Sequence: HILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKP | ||||||
Domain | 274-349 | RRM | ||||
Sequence: AVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length508
- Mass (Da)55,539
- Last updated2015-04-01 v1
- ChecksumBD712930A129647B
Computationally mapped potential isoform sequences
There are 17 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4K7I2 | A0A0B4K7I2_DROME | sm | 552 | ||
A0A0B4K7B0 | A0A0B4K7B0_DROME | sm | 494 | ||
A0A0B4K7W3 | A0A0B4K7W3_DROME | sm | 492 | ||
A0A0B4K7W7 | A0A0B4K7W7_DROME | sm | 540 | ||
A0A0B4K8A1 | A0A0B4K8A1_DROME | sm | 515 | ||
A0A0B4K7H8 | A0A0B4K7H8_DROME | sm | 535 | ||
A0A0B4K7I6 | A0A0B4K7I6_DROME | sm | 491 | ||
A0A0B4K852 | A0A0B4K852_DROME | sm | 497 | ||
A0A0C4DHD5 | A0A0C4DHD5_DROME | sm | 434 | ||
A1ZBN3 | A1ZBN3_DROME | sm | 404 | ||
A0A0B4KEV0 | A0A0B4KEV0_DROME | sm | 301 | ||
A0A0B4KF04 | A0A0B4KF04_DROME | sm | 509 | ||
Q0E914 | Q0E914_DROME | sm | 260 | ||
Q7JMZ7 | Q7JMZ7_DROME | sm | 475 | ||
Q6NND8 | Q6NND8_DROME | sm | 480 | ||
D5AEJ9 | D5AEJ9_DROME | sm | 464 | ||
Q8IHH3 | Q8IHH3_DROME | sm | 420 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | AFH08187.1 EMBL· GenBank· DDBJ | Genomic DNA |