A0A0B4JD00 · A0A0B4JD00_DROME
- Proteinphosphatidate phosphatase
- GeneLpin
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1034 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Catalytic activity
- a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphateThis reaction proceeds in the forward direction.
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | female germline ring canal inner rim | |
Cellular Component | nucleus | |
Molecular Function | phosphatidate phosphatase activity | |
Molecular Function | transcription coactivator activity | |
Biological Process | cellular response to insulin stimulus | |
Biological Process | fatty acid catabolic process | |
Biological Process | imaginal disc-derived wing vein specification | |
Biological Process | lipid homeostasis | |
Biological Process | negative regulation of BMP signaling pathway | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of cellular ketone metabolic process | |
Biological Process | regulation of fatty acid metabolic process | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | response to starvation | |
Biological Process | triglyceride biosynthetic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namephosphatidate phosphatase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionA0A0B4JD00
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 159-181 | Disordered | ||||
Sequence: VVEGSKFENQVSDYTQRRHTDNT | ||||||
Region | 209-415 | Disordered | ||||
Sequence: LFQGEKKPADSDSLDNQSKASNEAETEKAIPAVIEDTEKEKDQIKPDVNLTTVTTSEATKEVSKSKTKKRRKKSQMKKNAQRKNSSSSSLGSAGGGDLPSAETPSLGVSNIDEGDAPISSATNNNNTSSSNDEQLSAPLVTARTGDDSPLSEIPHTPTSNPRLDLDIHFFSDTEITTPVGGGGAGSGRAAGGRPSTPIQSDSELETT | ||||||
Compositional bias | 237-254 | Basic and acidic residues | ||||
Sequence: AIPAVIEDTEKEKDQIKP | ||||||
Compositional bias | 273-287 | Basic residues | ||||
Sequence: SKTKKRRKKSQMKKN | ||||||
Compositional bias | 288-302 | Polar residues | ||||
Sequence: AQRKNSSSSSLGSAG | ||||||
Compositional bias | 323-346 | Polar residues | ||||
Sequence: DAPISSATNNNNTSSSNDEQLSAP | ||||||
Region | 508-549 | Disordered | ||||
Sequence: PLSKAASPPEEDGESGNGTSLPHSPSSLEEGQKSIDSDFDET | ||||||
Compositional bias | 520-539 | Polar residues | ||||
Sequence: GESGNGTSLPHSPSSLEEGQ | ||||||
Region | 680-725 | Disordered | ||||
Sequence: APNHLNNTHGMPLGKDEKDGDQAAVATQTSRPTSPDITDPTLSKSD | ||||||
Compositional bias | 702-725 | Polar residues | ||||
Sequence: AAVATQTSRPTSPDITDPTLSKSD | ||||||
Domain | 807-962 | LNS2/PITP | ||||
Sequence: VVISDIDGTITKSDVLGHILPMVGKDWAQLGVAQLFSKIEQNGYKLLYLSARAIGQSRVTREYLRSIRQGNVMLPDGPLLLNPTSLISAFHREVIEKKPEQFKIACLSDIRDLFPDKEPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHE |
Sequence similarities
Belongs to the lipin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,034
- Mass (Da)114,694
- Last updated2015-04-01 v1
- ChecksumF5230F8AE6510909
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q8SXP0 | Q8SXP0_DROME | Lpin | 1089 | ||
A0A0B4JCS1 | A0A0B4JCS1_DROME | Lpin | 1016 | ||
A0A0B4JD31 | A0A0B4JD31_DROME | Lpin | 992 | ||
A0A0B4JCQ5 | A0A0B4JCQ5_DROME | Lpin | 1088 | ||
A0A0B4JD27 | A0A0B4JD27_DROME | Lpin | 1045 | ||
A8DY69 | A8DY69_DROME | Lpin | 1035 | ||
I0E2I4 | I0E2I4_DROME | Lpin | 1043 | ||
E5DK16 | E5DK16_DROME | Lpin | 962 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 237-254 | Basic and acidic residues | ||||
Sequence: AIPAVIEDTEKEKDQIKP | ||||||
Compositional bias | 273-287 | Basic residues | ||||
Sequence: SKTKKRRKKSQMKKN | ||||||
Compositional bias | 288-302 | Polar residues | ||||
Sequence: AQRKNSSSSSLGSAG | ||||||
Compositional bias | 323-346 | Polar residues | ||||
Sequence: DAPISSATNNNNTSSSNDEQLSAP | ||||||
Compositional bias | 520-539 | Polar residues | ||||
Sequence: GESGNGTSLPHSPSSLEEGQ | ||||||
Compositional bias | 702-725 | Polar residues | ||||
Sequence: AAVATQTSRPTSPDITDPTLSKSD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE013599 EMBL· GenBank· DDBJ | ADV37123.1 EMBL· GenBank· DDBJ | Genomic DNA |