A0A0B2SI36 · A0A0B2SI36_GLYSO
- ProteinMultifunctional fusion protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids804 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
- ATP + cytidine = ADP + CMP + H+
Pathway
Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
Pyrimidine metabolism; CTP biosynthesis via salvage pathway; CTP from cytidine: step 1/3.
Pyrimidine metabolism; UMP biosynthesis via salvage pathway; UMP from uridine: step 1/1.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | cytidine kinase activity | |
Molecular Function | fructose-bisphosphate aldolase activity | |
Molecular Function | GTP binding | |
Molecular Function | uracil phosphoribosyltransferase activity | |
Molecular Function | uridine kinase activity | |
Biological Process | CTP salvage | |
Biological Process | glycolytic process | |
Biological Process | UMP salvage |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMultifunctional fusion protein
Including 2 domains:
- Recommended nameUridine kinase
- EC number
- Recommended nameFructose-bisphosphate aldolase
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Glycine > Glycine subgen. Soja
Accessions
- Primary accessionA0A0B2SI36
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 49-236 | Phosphoribulokinase/uridine kinase | ||||
Sequence: VIGVAGGAASGKTSVCDMIVQQLHDQRVVLVNQDSFYHNLTQEELTRVQDYNFDHPEAFDTEQLLRVMDKLKRGQAVDIPNYDFKGYKNDVFPARRVNPADVIILEGILVFHDPRVRALMNMKIFVDTDADVRLARRIKRDTADNARDIGAVLDQYSKFVKPAFDDFILPTKKYADIIIPRGRDNHVA |
Sequence similarities
Belongs to the class I fructose-bisphosphate aldolase family.
Belongs to the uridine kinase family.
In the C-terminal section; belongs to the UPRTase family.
In the N-terminal section; belongs to the uridine kinase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length804
- Mass (Da)88,776
- Last updated2015-03-04 v1
- Checksum1B07DBE4A703CC3F