A0A0A7RRZ9 · A0A0A7RRZ9_9MONO
- ProteinPhosphoprotein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids509 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Essential cofactor of the RNA polymerase L that plays a central role in the transcription and replication by forming the polymerase complex with RNA polymerase L and recruiting L to the genomic N-RNA template for RNA synthesis. Plays also a central role in the encapsidation of nascent RNA chains by forming the encapsidation complex with the nucleocapsid protein N (N-P complex). Acts as a chaperone for newly synthesized free N protein, so-called N0, allowing encapsidation of nascent RNA chains during replication. The nucleoprotein protein N prevents excessive phosphorylation of P, which leads to down-regulation of viral transcription/ replication. Participates, together with N, in the formation of viral factories (viroplasms), which are large inclusions in the host cytoplasm where replication takes place.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | RNA binding | |
Molecular Function | RNA-dependent RNA polymerase activity | |
Biological Process | DNA-templated transcription | |
Biological Process | viral genome replication |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePhosphoprotein
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Haploviricotina > Monjiviricetes > Mononegavirales > Paramyxoviridae > Orthoparamyxovirinae > Morbillivirus
Accessions
- Primary accessionA0A0A7RRZ9
Proteomes
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-312 | Paramyxovirus structural protein P/V N-terminal | ||||
Sequence: EQAYHVNKGLECIKSLKASPPDLSTIRDTIESWREGLSPSGRATPNPDTSEGDHQNINQSCSPAIGPNKVYLSPEDNLGFREITGNDCEAGLGGVQREGSNSQVQRYHVYSHGGEEIEGLEDADSLVVQADPPVANVFNGGEDGSDDSDVDSGPDDPGRDTLYDRGSVAGNGIARSTDVEKLEGADIQEVLNSQKGKGGRFKGGKTLRVPEIPDVKHSRPSAQSIKKGTDGNSVSSGTVIECLSISGATQTVPESRWESSEQNASVGSVLKSARSAKTIQGSTQESGTIASLTQPKENDSEYEYEDDLF | ||||||
Region | 21-106 | Disordered | ||||
Sequence: ASPPDLSTIRDTIESWREGLSPSGRATPNPDTSEGDHQNINQSCSPAIGPNKVYLSPEDNLGFREITGNDCEAGLGGVQREGSNSQ | ||||||
Compositional bias | 45-69 | Polar residues | ||||
Sequence: RATPNPDTSEGDHQNINQSCSPAIG | ||||||
Region | 137-173 | Disordered | ||||
Sequence: VANVFNGGEDGSDDSDVDSGPDDPGRDTLYDRGSVAG | ||||||
Region | 194-236 | Disordered | ||||
Sequence: LNSQKGKGGRFKGGKTLRVPEIPDVKHSRPSAQSIKKGTDGNS | ||||||
Compositional bias | 210-226 | Basic and acidic residues | ||||
Sequence: LRVPEIPDVKHSRPSAQ | ||||||
Compositional bias | 279-300 | Polar residues | ||||
Sequence: AKTIQGSTQESGTIASLTQPKE | ||||||
Region | 279-302 | Disordered | ||||
Sequence: AKTIQGSTQESGTIASLTQPKEND |
Sequence similarities
Belongs to the morbillivirus P protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length509
- Mass (Da)54,787
- Last updated2015-03-04 v1
- Checksum54E84EB006D131D0
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 45-69 | Polar residues | ||||
Sequence: RATPNPDTSEGDHQNINQSCSPAIG | ||||||
Compositional bias | 210-226 | Basic and acidic residues | ||||
Sequence: LRVPEIPDVKHSRPSAQ | ||||||
Compositional bias | 279-300 | Polar residues | ||||
Sequence: AKTIQGSTQESGTIASLTQPKE |
Keywords
- Coding sequence diversity