A0A0A0RKV3 · A0A0A0RKV3_SIV
- ProteinEnvelope glycoprotein gp160
- Geneenv
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids887 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endosome membrane | |
Cellular Component | host cell plasma membrane | |
Cellular Component | plasma membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Molecular Function | structural molecule activity | |
Biological Process | apoptotic process | |
Biological Process | membrane fusion involved in viral entry into host cell | |
Biological Process | symbiont entry into host cell | |
Biological Process | virion attachment to host cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEnvelope glycoprotein gp160
- Cleaved into 2 chains
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Riboviria > Pararnavirae > Artverviricota > Revtraviricetes > Ortervirales > Retroviridae > Orthoretrovirinae > Lentivirus
- Virus hosts
Accessions
- Primary accessionA0A0A0RKV3
Subcellular Location
UniProt Annotation
GO Annotation
Host cell membrane ; Peripheral membrane protein
Host cell membrane ; Single-pass type I membrane protein
Host endosome membrane ; Peripheral membrane protein
Host endosome membrane ; Single-pass type I membrane protein
Virion membrane ; Peripheral membrane protein
Virion membrane ; Single-pass type I membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 698-719 | Helical | ||||
Sequence: YIQYGVLIVLGVVGLRIVIYVV |
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Interaction
Subunit
The mature envelope protein (Env) consists of a homotrimer of non-covalently associated gp120-gp41 heterodimers. The resulting complex protrudes from the virus surface as a spike.
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-533 | Human immunodeficiency virus 1 envelope glycoprotein Gp120 | ||||
Sequence: QYVTVFYGVPAWKNATIPLFCTTRNRDTWGTTQCLPDNDDYSELAISITEAFDAWNNTVTEQAIEDVWNLFETSIKPCVKLTPLCIAMRCNKTETDRWGLTRNAGTTTTTTTTTTAATPSVAENVINESNPCIKNNSCAGLEQEPMIGCKFNMTGLKRDKRIEYNETWYSRDLICEQSANESESKCYMHHCNTSVIQESCDKHYWDAIRFRYCAPPGYALLRCNDSNYSGFAPNCSKVVVSSCTRMMETQTSTWFGFNGTRAENRTYIYWHGKSNRTIISLNKYYNLTMRCRRPGNKTVLPVTIMSGLVFHSQPINERPKQAWCWFGGSWKEAIQEVKETLVKHPRYTGTNDTKKINLTAPAGGDPEVTFMWTNCRGEFLYCKMNWFLNWVEDRDQKSSRWRQQNTRERQKKNYVPCHIRQIINTWHKVGKNVYLLPREGDLTCNSTVTSLIAEIDWTNNNETNITMSAEVAELYRLELGDYKLVEITPIGLAPTSVRRYTTTGASRNKR | ||||||
Domain | 551-745 | Retroviral envelope protein GP41-like | ||||
Sequence: MGAASLTLSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQTRVTAIEKYLKDQAQLNSWGCAFRQVCHTTVPWPNETLVPNWSNMTWQEWERQVDFLEANITQLLEEAQIQQEKNMYELQKLNSWDIFGNWFDLTSWIRYIQYGVLIVLGVVGLRIVIYVVQMLARLRQGYRPVFSSPPAYVQQIPI | ||||||
Coiled coil | 645-672 | |||||
Sequence: WQEWERQVDFLEANITQLLEEAQIQQEK | ||||||
Region | 745-766 | Disordered | ||||
Sequence: IHKGQEPPTKEGEEGEGGDRGG | ||||||
Compositional bias | 750-764 | Basic and acidic residues | ||||
Sequence: EPPTKEGEEGEGGDR |
Domain
The 17 amino acids long immunosuppressive region is present in many retroviral envelope proteins. Synthetic peptides derived from this relatively conserved sequence inhibit immune function in vitro and in vivo.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length887
- Mass (Da)102,212
- Last updated2015-02-04 v1
- ChecksumFB71284E0D716AA3
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 750-764 | Basic and acidic residues | ||||
Sequence: EPPTKEGEEGEGGDR |