A0A0A0N2S8 · A0A0A0N2S8_9DINO
- ProteinCytochrome b6
- GenepetB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids218 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 2 heme b groups non-covalently with two histidine residues as axial ligands.
Note: Binds one heme group covalently by a single cysteine link with no axial amino acid ligand.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Molecular Function | electron transfer activity | |
Molecular Function | metal ion binding | |
Molecular Function | oxidoreductase activity | |
Biological Process | photosynthesis | |
Biological Process | respiratory electron transport chain |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome b6
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Sar > Alveolata > Dinophyceae > Suessiales > Symbiodiniaceae > Symbiodinium
Accessions
- Primary accessionA0A0A0N2S8
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 31-55 | Helical | ||||
Sequence: IFYCFGGVVSLLLLFQIISGLGLTM | ||||||
Transmembrane | 61-80 | Helical | ||||
Sequence: VVSAFSSVLNIVGQVYLGWL | ||||||
Transmembrane | 92-109 | Helical | ||||
Sequence: MVSALILHAFRVYLTGGF | ||||||
Transmembrane | 115-139 | Helical | ||||
Sequence: LIWMTGIILGVCTVLFGVTGYSLAW | ||||||
Transmembrane | 160-180 | Helical | ||||
Sequence: LLFGVGFLLVLIIRGGFSVSS | ||||||
Transmembrane | 186-207 | Helical | ||||
Sequence: FYSIHTFLLPIVTLSLVIIHFI |
Keywords
- Cellular component
Interaction
Subunit
The 4 large subunits of the cytochrome b6-f complex are cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are PetG, PetL, PetM and PetN. The complex functions as a dimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-218 | Cytochrome b/b6 N-terminal region profile | ||||
Sequence: LYDWSEEGLEIQCIGDDILGKLVPPHVNIFYCFGGVVSLLLLFQIISGLGLTMYYTPSVVSAFSSVLNIVGQVYLGWLNRSIHRWSGSSMVSALILHAFRVYLTGGFKKARELIWMTGIILGVCTVLFGVTGYSLAWDQVGYWACKIVTGVPEGLDKLLFGVGFLLVLIIRGGFSVSSGRLTRFYSIHTFLLPIVTLSLVIIHFIQIRKQGISGPL |
Sequence similarities
Belongs to the cytochrome b family. PetB subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length218
- Mass (Da)24,127
- Last updated2015-02-04 v1
- Checksum71A9296A444E6F14