A0A0A0MQ10 · A0A0A0MQ10_FELCA

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytosol
Cellular Componentexternal side of plasma membrane
Cellular Componentextracellular region
Cellular ComponentGolgi apparatus
Cellular ComponentHFE-transferrin receptor complex
Cellular Componentlate endosome membrane
Cellular Componentlysosomal membrane
Cellular ComponentMHC class I peptide loading complex
Cellular ComponentMHC class I protein complex
Cellular ComponentMHC class II protein complex
Molecular FunctionMHC class II protein complex binding
Molecular Functionpeptide antigen binding
Molecular Functionprotein homodimerization activity
Molecular Functionstructural molecule activity
Biological Processamyloid fibril formation
Biological Processantigen processing and presentation of endogenous peptide antigen via MHC class I
Biological Processantigen processing and presentation of exogenous peptide antigen via MHC class II
Biological Processantigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
Biological Processcellular response to iron(III) ion
Biological Processcellular response to nicotine
Biological Processintracellular iron ion homeostasis
Biological Processiron ion transport
Biological Processlearning or memory
Biological Processmulticellular organismal-level iron ion homeostasis
Biological Processnegative regulation of epithelial cell proliferation
Biological Processnegative regulation of forebrain neuron differentiation
Biological Processnegative regulation of neurogenesis
Biological Processnegative regulation of neuron projection development
Biological Processpeptide antigen assembly with MHC class I protein complex
Biological Processpeptide antigen assembly with MHC class II protein complex
Biological Processpositive regulation of cellular senescence
Biological Processpositive regulation of immune response
Biological Processpositive regulation of receptor-mediated endocytosis
Biological Processpositive regulation of T cell activation
Biological Processpositive regulation of T cell cytokine production
Biological Processpositive regulation of T cell mediated cytotoxicity
Biological Processprotein homotetramerization
Biological Processprotein refolding
Biological Processregulation of erythrocyte differentiation
Biological Processregulation of iron ion transport
Biological Processresponse to molecule of bacterial origin
Biological Processsensory perception of smell
Biological ProcessT cell differentiation in thymus
Biological ProcessT cell mediated cytotoxicity

Keywords

  • Biological process

Names & Taxonomy

Protein names

  • Recommended name
    Beta-2-microglobulin

Gene names

    • Name
      B2M

Organism names

  • Taxonomic identifier
  • Strain
    • Abyssinian
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Feliformia > Felidae > Felinae > Felis

Accessions

  • Primary accession
    A0A0A0MQ10

Proteomes

Organism-specific databases

PTM/Processing

Features

Showing features for signal, chain.

TypeIDPosition(s)Description
Signal1-20
ChainPRO_500196716421-118Beta-2-microglobulin

Expression

Gene expression databases

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain25-112Ig-like

Sequence similarities

Belongs to the beta-2-microglobulin family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    118
  • Mass (Da)
    13,712
  • Last updated
    2015-01-07 v1
  • Checksum
    192E2AA7B55B0A44
MARFVVLVLLGLLYLSHLDAVQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVMWERDK

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AANG04001761
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp