A0A096ML87 · A0A096ML87_PAPAN
- Protein[histone H3]-trimethyl-L-lysine(9) demethylase
- GeneKDM4A
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1063 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Catalytic activity
- N6,N6,N6-trimethyl-L-lysyl9-[histone H3] + 2 2-oxoglutarate + 2 O2 = N6-methyl-L-lysyl9-[histone H3] + 2 formaldehyde + 2 succinate + 2 CO2
RHEA-COMP:15538 CHEBI:61961 Position: 9+ 2 CHEBI:16810 + 2 CHEBI:15379 = RHEA-COMP:15542 CHEBI:61929 Position: 9+ 2 CHEBI:16842 + 2 CHEBI:30031 + 2 CHEBI:16526
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | fibrillar center | |
Cellular Component | nucleoplasm | |
Cellular Component | pericentric heterochromatin | |
Molecular Function | histone H3K36 demethylase activity | |
Molecular Function | histone H3K9me2/H3K9me3 demethylase activity | |
Molecular Function | methylated histone binding | |
Molecular Function | ubiquitin protein ligase binding | |
Molecular Function | zinc ion binding | |
Biological Process | cardiac muscle hypertrophy in response to stress | |
Biological Process | negative regulation of autophagy | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of gene expression |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name[histone H3]-trimethyl-L-lysine(9) demethylase
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Cercopithecinae > Papio
Accessions
- Primary accessionA0A096ML87
Proteomes
Subcellular Location
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 14-56 | JmjN | ||||
Sequence: IMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPR | ||||||
Domain | 142-308 | JmjC | ||||
Sequence: EKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSC | ||||||
Region | 358-384 | Disordered | ||||
Sequence: ELPPRAGNEEECPEEDMEGVEDGEEGD | ||||||
Coiled coil | 462-489 | |||||
Sequence: VKFEELKNVKLEEEDEEEEQEAAALDLS | ||||||
Region | 499-536 | Disordered | ||||
Sequence: LVFSGSQKKSPSLGSGSSRDSISSDSETSEPLSCRAQG | ||||||
Compositional bias | 501-536 | Polar residues | ||||
Sequence: FSGSQKKSPSLGSGSSRDSISSDSETSEPLSCRAQG | ||||||
Region | 615-640 | Disordered | ||||
Sequence: SDDETSEQLTPEEEAEETEAWAKPLS | ||||||
Domain | 771-884 | PHD-type | ||||
Sequence: EEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHK |
Sequence similarities
Belongs to the JHDM3 histone demethylase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,063
- Mass (Da)120,606
- Last updated2014-11-26 v1
- Checksum9CDCE99EBBEB9128
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 501-536 | Polar residues | ||||
Sequence: FSGSQKKSPSLGSGSSRDSISSDSETSEPLSCRAQG |
Keywords
- Technical term