A0A087WTY2 · A0A087WTY2_HUMAN
- ProteinHexosaminidase subunit alpha
- GeneHEXA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids119 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A087WTY2
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 172 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MTSSRLWFSLLLAAAFAGRATA | ||||||
Chain | PRO_5042327122 | 23-119 | ||||
Sequence: LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGLSLSFRLECSGVITAYSNLELQDSSSLPASLMSS |
Expression
Gene expression databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length119
- Mass (Da)13,323
- Last updated2014-10-29 v1
- Checksum8FDB43A5B21BEFA7
Computationally mapped potential isoform sequences
There are 18 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P06865 | HEXA_HUMAN | HEXA | 529 | ||
H3BVH8 | H3BVH8_HUMAN | HEXA | 134 | ||
H3BU85 | H3BU85_HUMAN | HEXA | 360 | ||
H3BT62 | H3BT62_HUMAN | HEXA | 143 | ||
H3BTD4 | H3BTD4_HUMAN | HEXA | 373 | ||
H3BRP6 | H3BRP6_HUMAN | HEXA | 88 | ||
H3BS10 | H3BS10_HUMAN | HEXA | 509 | ||
H3BQ04 | H3BQ04_HUMAN | HEXA | 143 | ||
H3BP20 | H3BP20_HUMAN | HEXA | 540 | ||
A0A804HIQ5 | A0A804HIQ5_HUMAN | HEXA | 485 | ||
A0A804HJ97 | A0A804HJ97_HUMAN | HEXA | 257 | ||
A0A804HIU3 | A0A804HIU3_HUMAN | HEXA | 358 | ||
A0A804HIC7 | A0A804HIC7_HUMAN | HEXA | 121 | ||
A0A804HIC8 | A0A804HIC8_HUMAN | HEXA | 390 | ||
A0A804HLJ5 | A0A804HLJ5_HUMAN | HEXA | 474 | ||
A0A804HK32 | A0A804HK32_HUMAN | HEXA | 90 | ||
A0A804HJK0 | A0A804HJK0_HUMAN | HEXA | 96 | ||
A0A804HKX5 | A0A804HKX5_HUMAN | HEXA | 473 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009690 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF456090 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |