A0A087WRB8 · A0A087WRB8_MOUSE
- ProteinDystonin
- GeneDst
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1471 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | microtubule | |
Molecular Function | actin binding | |
Biological Process | intermediate filament cytoskeleton organization |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionA0A087WRB8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Expression
Gene expression databases
Family & Domains
Features
Showing features for compositional bias, region, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-35 | Polar residues | ||||
Sequence: MSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAP | ||||||
Region | 1-57 | Disordered | ||||
Sequence: MSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWNLPKHERSKRKIQGGS | ||||||
Domain | 75-178 | Calponin-homology (CH) | ||||
Sequence: KVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQ | ||||||
Domain | 191-295 | Calponin-homology (CH) | ||||
Sequence: MSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFP | ||||||
Coiled coil | 781-808 | |||||
Sequence: HAELMRELEQKEESIKAVQEIAEQLLLE | ||||||
Domain | 926-983 | SH3 | ||||
Sequence: KTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPP | ||||||
Coiled coil | 1247-1281 | |||||
Sequence: IENLMSTLKQWRSEVDEKREVFHALEDELQKAKAI |
Sequence similarities
Belongs to the plakin or cytolinker family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length1,471
- Mass (Da)170,209
- Last updated2014-10-29 v1
- Checksum40ECA2095F7219A5
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q91ZU6 | DYST_MOUSE | Dst | 7393 | ||
A0A0A6YX28 | A0A0A6YX28_MOUSE | Dst | 274 | ||
A0A0A6YXR1 | A0A0A6YXR1_MOUSE | Dst | 282 | ||
A0A5F8MPU9 | A0A5F8MPU9_MOUSE | Dst | 153 | ||
S4R1P5 | S4R1P5_MOUSE | Dst | 7717 | ||
S4R2A8 | S4R2A8_MOUSE | Dst | 262 | ||
S4R1Y6 | S4R1Y6_MOUSE | Dst | 1638 | ||
S4R2C6 | S4R2C6_MOUSE | Dst | 259 | ||
A0A087WPR7 | A0A087WPR7_MOUSE | Dst | 2987 | ||
A0A087WSP0 | A0A087WSP0_MOUSE | Dst | 5175 | ||
A0A571BGG5 | A0A571BGG5_MOUSE | Dst | 386 | ||
A0A1D5RLZ3 | A0A1D5RLZ3_MOUSE | Dst | 1674 |
Features
Showing features for compositional bias, non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-35 | Polar residues | ||||
Sequence: MSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAP | ||||||
Non-terminal residue | 1471 | |||||
Sequence: E |
Keywords
- Technical term