A0A084GH11 · A0A084GH11_PSEDA
- ProteinSuccinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids330 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of ATP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
Catalytic activity
- ATP + CoA + succinate = ADP + phosphate + succinyl-CoA
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 48-51 | CoA (UniProtKB | ChEBI) | ||||
Sequence: TGKQ | ||||||
Binding site | 74 | CoA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 127-129 | CoA (UniProtKB | ChEBI) | ||||
Sequence: ITE | ||||||
Binding site | 191 | substrate; ligand shared with subunit beta | ||||
Sequence: Y | ||||||
Active site | 283 | Tele-phosphohistidine intermediate | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | succinate-CoA ligase complex (ADP-forming) | |
Molecular Function | nucleotide binding | |
Molecular Function | succinate-CoA ligase (ADP-forming) activity | |
Molecular Function | succinate-CoA ligase (GDP-forming) activity | |
Biological Process | tricarboxylic acid cycle |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSuccinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Microascales > Microascaceae > Scedosporium
Accessions
- Primary accessionA0A084GH11
Proteomes
Organism-specific databases
Subcellular Location
Interaction
Subunit
Heterodimer of an alpha and a beta subunit.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-131 | CoA-binding | ||||
Sequence: RINSNTKVLYQGFTGKQGTFHAQQAIDYGTQVVGGTNPRKAGETHLGLPVFGTVSDAVKETGATASCIFVPPPLAAASIEEAIEAEIPLVVAITEGI |
Sequence similarities
Belongs to the succinate/malate CoA ligase alpha subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length330
- Mass (Da)34,486
- Last updated2014-10-29 v1
- ChecksumEA2E0EF0D2AEBA41
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JOWA01000022 EMBL· GenBank· DDBJ | KEZ46623.1 EMBL· GenBank· DDBJ | Genomic DNA |