A0A075F932 · SYT1_ANSCY
- ProteinSynaptotagmin-1
- GeneSYT1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids421 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Calcium sensor that participates in triggering neurotransmitter release at the synapse (By similarity).
May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. May play a role in dendrite formation by melanocytes (By similarity).
May play a role in regulating the secretion of hormones relevant to the reproduction and egg-laying of female geese (PubMed:25146222).
May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. May play a role in dendrite formation by melanocytes (By similarity).
May play a role in regulating the secretion of hormones relevant to the reproduction and egg-laying of female geese (PubMed:25146222).
Cofactor
Note: Binds 3 Ca2+ ions per subunit. The ions are bound to the C2 domains.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 171 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 172 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 172 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 178 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 230 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 230 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 231 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 232 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 232 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 232 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 235 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 236 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 238 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 238 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 303 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 303 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 309 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 363 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 363 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 365 | Ca2+ 4 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 365 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 371 | Ca2+ 5 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromaffin granule membrane | |
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | synaptic vesicle | |
Cellular Component | synaptic vesicle membrane | |
Molecular Function | calcium ion binding | |
Molecular Function | phospholipid binding | |
Biological Process | cell differentiation | |
Biological Process | multicellular organismal reproductive process | |
Biological Process | positive regulation of dendrite extension | |
Biological Process | regulation of calcium ion-dependent exocytosis | |
Biological Process | regulation of hormone secretion | |
Biological Process | regulation of regulated secretory pathway | |
Biological Process | response to calcium ion |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSynaptotagmin-1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Anseriformes > Anatidae > Anserinae > Anser
Accessions
- Primary accessionA0A075F932
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle membrane ; Single-pass membrane protein
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Single-pass membrane protein
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane ; Single-pass membrane protein
Note: Synaptic vesicles and chromaffin granules.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-60 | Vesicular | ||||
Sequence: MVSESHHEALAAPPATTVAAAPPSNVTEPASPGGGGGKEDAFSKLKEKFMNELNKIPLPP | ||||||
Transmembrane | 61-81 | Helical | ||||
Sequence: WALIAIAIVAVLLILTCCFCL | ||||||
Topological domain | 82-421 | Cytoplasmic | ||||
Sequence: CKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQPEEEVDAMLAVKK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000434728 | 1-421 | Synaptotagmin-1 | |||
Sequence: MVSESHHEALAAPPATTVAAAPPSNVTEPASPGGGGGKEDAFSKLKEKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQPEEEVDAMLAVKK | ||||||
Glycosylation | 25 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 77 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 78 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 80 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 82 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 85 | S-palmitoyl cysteine | ||||
Sequence: C |
Keywords
- PTM
PTM databases
Expression
Developmental stage
Expressed during egg-laying cycle in the hypothalamus and pituitary. Expression increases from the pre-laying period to the peak laying period reaching its highest level in the peak laying period and then decreases in the ceased period (PubMed:25146222).
Expression is up-regulated in the pituitary gland during egg-laying period and down-regulated during ceased period (PubMed:25049869).
Expression is up-regulated in the pituitary gland during egg-laying period and down-regulated during ceased period (PubMed:25049869).
Interaction
Subunit
Homotetramer (Probable).
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-40 | Disordered | ||||
Sequence: MVSESHHEALAAPPATTVAAAPPSNVTEPASPGGGGGKED | ||||||
Region | 94-139 | Disordered | ||||
Sequence: KGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEV | ||||||
Compositional bias | 98-123 | Basic and acidic residues | ||||
Sequence: KGGKNAINMKDVKDLGKTMKDQDDDA | ||||||
Region | 135-381 | Phospholipid binding | ||||
Sequence: EPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYN | ||||||
Domain | 141-260 | C2 1 | ||||
Sequence: KLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWR | ||||||
Domain | 272-405 | C2 2 | ||||
Sequence: KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWH |
Domain
The first C2 domain mediates Ca2+-dependent phospholipid binding.
The second C2 domain mediates interaction with SV2A and probably with STN2.
Sequence similarities
Belongs to the synaptotagmin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length421
- Mass (Da)47,208
- Last updated2014-10-29 v1
- ChecksumE6249E77D9495DCA
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 98-123 | Basic and acidic residues | ||||
Sequence: KGGKNAINMKDVKDLGKTMKDQDDDA |
Keywords
- Technical term