A0A066ZR71 · A0A066ZR71_HYDMR
- Proteinhydrogenase (acceptor)
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids377 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Catalytic activity
- A + H2 = AH2
Cofactor
Protein has several cofactor binding sites:
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 79 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 82 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 177 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 214 | [4Fe-4S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 252 | [4Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 252 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 255 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 255 | [4Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 280 | [4Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 280 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 286 | [4Fe-4S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 286 | [4Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 295 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 300 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 314 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 315 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: I | ||||||
Binding site | 316 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 317 | [3Fe-4S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | [Ni-Fe] hydrogenase complex | |
Cellular Component | ferredoxin hydrogenase complex | |
Cellular Component | membrane | |
Molecular Function | 3 iron, 4 sulfur cluster binding | |
Molecular Function | 4 iron, 4 sulfur cluster binding | |
Molecular Function | electron transfer activity | |
Molecular Function | ferredoxin hydrogenase activity | |
Molecular Function | hydrogenase (acceptor) activity | |
Molecular Function | metal ion binding | |
Biological Process | anaerobic respiration |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namehydrogenase (acceptor)
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Thiotrichales > Piscirickettsiaceae > Hydrogenovibrio
Accessions
- Primary accessionA0A066ZR71
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 79-227 | NADH:ubiquinone oxidoreductase-like 20kDa subunit | ||||
Sequence: CTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAASGHAAEAILDEIKEKYKGNYILAVEGNPPLNQDGMSCIIGGRPFSEQLKRMADDAKAIISWGSCASWGCVQAAKPNPTQATPVHKFLGGGYDKPIIKVPGCPPIAEVMTGVITY | ||||||
Domain | 247-328 | Cytochrome-c3 hydrogenase C-terminal | ||||
Sequence: YSQRIHDKCYRRPHFDAGQFVEEWDDEGARKGYCLYKVGCKGPTTYNACSTVRWNGGTSFPIQSGHGCIGCSEDGFWDKGSF |
Sequence similarities
Belongs to the [NiFe]/[NiFeSe] hydrogenase small subunit family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length377
- Mass (Da)41,026
- Last updated2014-09-03 v1
- ChecksumEBC16319DDDC68FF
Keywords
- Technical term