A0A062WPD2 · A0A062WPD2_9ACTN
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids510 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- ATP + glycerol = ADP + H+ + sn-glycerol 3-phosphate
Activity regulation
Inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 17 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 17 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 17 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 18 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 87 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 87 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 88 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 88 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 139 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 139 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 249 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 249 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 250 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 271 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 271 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 315 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 315 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 415 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 415 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 419 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol-3-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Actinomycetota > Actinomycetes > Frankiales > Frankiaceae > Frankia
Accessions
- Primary accessionA0A062WPD2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 10-255 | Carbohydrate kinase FGGY N-terminal | ||||
Sequence: VAAVDQGTTGTTVCLLDRDGVVVGRGYTGIRPGFPRPGWVEQDPDELWRSVVDTVAAALAGCGRRAGELAALGITNQRETTVLWDRRTSAPVHPAIGWQDRRTAAVCERLTAEGHAGAVGERTGLVLDPYFSGTKIGWILDDDPGLRRRAGRGEIAFGTVDSWLVWKLTAGAAHVTDVTNASRTLLLDLAAATWSPEMLDLLGVPAEVLPAVAPSSRVYAETDPDAFLGVRIPVAAVIGDQQAALF | ||||||
Domain | 266-454 | Carbohydrate kinase FGGY C-terminal | ||||
Sequence: KNTYGTGSFVLVNTGSALPAPQSTLLRTAAFQLDGEPVRYALEGAVLSTGAAVDWLRDSLGIIRDATETADLAASLTGNDGVYFVPALAGLGAPHWDPRARGALLGITRGTTRAHVVRAVLEGIAYRTRDVVEAMGAAGFPVRELRADGGAARNHWLMQFQADLLGVELDVPDNIETTALGSAYLAGLA |
Sequence similarities
Belongs to the FGGY kinase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length510
- Mass (Da)54,510
- Last updated2014-09-03 v1
- Checksum19929EB83B4B6D0A
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JDWE01000034 EMBL· GenBank· DDBJ | KDA41947.1 EMBL· GenBank· DDBJ | Genomic DNA |