A0A061CSK3 · A0A061CSK3_PSEOL
- ProteinSuccinate--CoA ligase [ADP-forming] subunit alpha
- GenesucD
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids295 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit.
Catalytic activity
- ATP + CoA + succinate = ADP + phosphate + succinyl-CoA
- CoA + GTP + succinate = GDP + phosphate + succinyl-CoA
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 17-20 | CoA (UniProtKB | ChEBI) | ||||
Sequence: TGSQ | ||||||
Binding site | 43 | CoA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 96-98 | CoA (UniProtKB | ChEBI) | ||||
Sequence: ITE | ||||||
Binding site | 159 | substrate; ligand shared with subunit beta | ||||
Sequence: Y | ||||||
Active site | 247 | Tele-phosphohistidine intermediate | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | nucleotide binding | |
Molecular Function | succinate-CoA ligase (ADP-forming) activity | |
Biological Process | tricarboxylic acid cycle |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSuccinate--CoA ligase [ADP-forming] subunit alpha
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Pseudomonadales > Pseudomonadaceae > Pseudomonas > Pseudomonas oleovorans/pseudoalcaligenes group
Accessions
- Primary accessionA0A061CSK3
- Secondary accessions
Proteomes
Interaction
Subunit
Heterotetramer of two alpha and two beta subunits.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-100 | CoA-binding | ||||
Sequence: LINKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVKEAVEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGI |
Sequence similarities
Belongs to the succinate/malate CoA ligase alpha subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length295
- Mass (Da)30,187
- Last updated2014-09-03 v1
- ChecksumBA997A2C51B15F07
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JAOEDG010000070 EMBL· GenBank· DDBJ | MDG9980290.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JAOCJE010000001 EMBL· GenBank· DDBJ | MDH1341275.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
RHRS01000009 EMBL· GenBank· DDBJ | RRW38074.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UGUV01000002 EMBL· GenBank· DDBJ | SUD53347.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UGUW01000004 EMBL· GenBank· DDBJ | SUD60291.1 EMBL· GenBank· DDBJ | Genomic DNA |