A0A060UPI5 · A0A060UPI5_9PROT
- ProteintRNA-dihydrouridine(20/20a) synthase
- GeneyjbN
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids359 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the synthesis of 5,6-dihydrouridine (D), a modified base found in the D-loop of most tRNAs, via the reduction of the C5-C6 double bond in target uridines. Specifically modifies U20 and U20a in tRNAs.
Catalytic activity
- 5,6-dihydrouridine20 in tRNA + NAD+ = uridine20 in tRNA + NADH + H+
- 5,6-dihydrouridine(20a) in tRNA + NAD+ = uridine(20a) in tRNA + NADH + H+
- 5,6-dihydrouridine(20a) in tRNA + NADP+ = uridine(20a) in tRNA + NADPH + H+
Cofactor
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 18-20 | FMN (UniProtKB | ChEBI) | ||||
Sequence: PML | ||||||
Binding site | 72 | FMN (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Site | 99 | Interacts with tRNA | ||||
Sequence: N | ||||||
Active site | 102 | Proton donor | ||||
Sequence: C | ||||||
Binding site | 140 | FMN (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 172 | FMN (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 187 | Interacts with tRNA | ||||
Sequence: R | ||||||
Binding site | 212-214 | FMN (UniProtKB | ChEBI) | ||||
Sequence: NGG | ||||||
Binding site | 234-235 | FMN (UniProtKB | ChEBI) | ||||
Sequence: GR | ||||||
Site | 301 | Interacts with tRNA; defines subfamily-specific binding signature | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | FMN binding | |
Molecular Function | tRNA binding | |
Molecular Function | tRNA-dihydrouridine20 synthase activity | |
Molecular Function | tRNA-dihydrouridine20a synthase activity |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nametRNA-dihydrouridine(20/20a) synthase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Acidithiobacillia > Acidithiobacillales > Acidithiobacillaceae > Acidithiobacillus
Accessions
- Primary accessionA0A060UPI5
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-317 | DUS-like FMN-binding | ||||
Sequence: VAPMLDWTDRHCRYFLRLVCPSCVLYTEMVTTSALLLGRDPERFLEFSAAEHPLILQLGGDDPAAMRAAAAMAHAYGYDGINLNVGCPSPRVQKGRFGACLMTTPELVAELVAAMGESGLPISVKHRLGLDREEDYATLRAFIETVAMVGCRHFIVHARNAWLKGLSPAENRDVPPLRWDWVHQLKKELPHLTIEINGGFNDLTVVTAQFSAVDGVMIGRSAYHHPLLLAEIERAMGRRETLPVPAVILSGLIEYAEQWGEALPAPRLSRHLHGLRFGQNGAGAWRRFLGTAETGESAAEFL |
Sequence similarities
Belongs to the Dus family. DusA subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length359
- Mass (Da)39,667
- Last updated2014-09-03 v1
- ChecksumC1D7952C0BF5A550