A0A016S9R7 · A0A016S9R7_9BILA
- ProteinHelicase ATP-binding domain-containing protein
- GeneAcey_s0268.g770
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids997 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | 4 iron, 4 sulfur cluster binding | |
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Molecular Function | DNA helicase activity | |
Molecular Function | DNA polymerase binding | |
Molecular Function | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | |
Molecular Function | metal ion binding | |
Biological Process | DNA repair | |
Biological Process | negative regulation of DNA recombination | |
Biological Process | negative regulation of t-circle formation | |
Biological Process | regulation of double-strand break repair via homologous recombination | |
Biological Process | telomeric loop disassembly |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameHelicase ATP-binding domain-containing protein
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Strongyloidea > Ancylostomatidae > Ancylostomatinae > Ancylostoma
Accessions
- Primary accessionA0A016S9R7
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-287 | Helicase ATP-binding | ||||
Sequence: RGVDVMFPFSPYECQLAYMDKVIEAIDMKFDTALESPTGTGKTLSLLCSTLGWLQKQKLMFQASFQDVAAQMATGSATSLSTFLPRIYYCSRTHSQLAQVVRELNRTMYKDIRTTVLGSRDQLCIHDKVSREMDTRVKTAMCRGMVSKHTCYYYNNWDKTSTSDLNEIFTVDGGVPDIEDMVTIGRRHSMCPFYRCRQMQETAELVLLPYNYIIDPHLRKIHKVDLSGSIVIFDEAHNLESVCESVVSVEFSSINIAMAIEELKDAIETLRSETEELRSEL | ||||||
Coiled coil | 262-293 | |||||
Sequence: IAMAIEELKDAIETLRSETEELRSELDNSTQA |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length997
- Mass (Da)111,697
- Last updated2014-06-11 v1
- Checksum3E1DCB52DDAF3BD5
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A016S8Y5 | A0A016S8Y5_9BILA | Acey_s0268.g770 | 1022 | ||
A0A016S9Z1 | A0A016S9Z1_9BILA | Acey_s0268.g770 | 943 | ||
A0A016S8Y8 | A0A016S8Y8_9BILA | Acey_s0268.g770 | 118 | ||
A0A016S8W0 | A0A016S8W0_9BILA | Acey_s0268.g770 | 986 | ||
A0A016S9L0 | A0A016S9L0_9BILA | Acey_s0268.g770 | 1011 |
Keywords
- Technical term