Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (18 Sep 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fumarate hydratase 2

Gene

FUM2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytosolic fumarate hydratase that catalyzes the reversible stereospecific interconversion of fumarate to L-malate (PubMed:29688630). Catalyzes the dehydration of L-malate to fumarate in the cytosol: required for the massive fumarate accumulation during the day in plants grown under high nitrogen (PubMed:20202172). Also required for acclimation of photosynthesis to cold: acts by mediating accumulation of fumarate at low temperature, leading to reduce accumulation of phosphorylated sugars (PubMed:27440755).3 Publications

Miscellaneous

There are 2 substrate-binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Fumarate hydratase activity (fumarate to L-malate) is strongly inhibited by phosphoenolpyruvate, citrate, oxaloacetate, ATP and ADP (PubMed:29688630). Malate dehydratase activity (malate to fumarate) is activated by oxaloacetate, Asn and Gln (PubMed:29688630). Malate dehydratase activity (malate to fumarate) is inhibited by citrate, succinate, ADP and ATP (PubMed:29688630).1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat is 23.04 sec(-1) for fumarate (at pH 7.7) (PubMed:29688630). Kcat is 22.15 sec(-1) for fumarate (at pH 8.0) (PubMed:29688630). Kcat is 18.3 sec(-1) for fumarate (at pH 8.2) (PubMed:29688630). Kcat is 5.22 sec(-1) for (S)-malate (at pH 7.7) (PubMed:29688630). Kcat is 14.79 sec(-1) for (S)-malate (at pH 8.0) (PubMed:29688630). Kcat is 17.1 sec(-1) for (S)-malate (at pH 8.2) (PubMed:29688630).1 Publication
  1. KM=0.4 mM for fumarate (at pH 7.7)1 Publication
  2. KM=0.6 mM for (S)-malate (at pH 7.7)1 Publication
  3. KM=0.5 mM for fumarate (at pH 8.0)1 Publication
  4. KM=1.7 mM for (S)-malate (at pH 8.0)1 Publication
  5. KM=0.5 mM for fumarate (at pH 8.2)1 Publication
  6. KM=1.9 mM for (S)-malate (at pH 8.2)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei222SubstrateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei223Proton donor/acceptorBy similarity1
    Active sitei353By similarity1
    Binding sitei354SubstrateBy similarity1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei366Important for catalytic activityBy similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionLyase

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    ARA:AT5G50950-MONOMER
    MetaCyc:AT5G50950-MONOMER

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    4.2.1.2 399

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Fumarate hydratase 21 Publication (EC:4.2.1.21 Publication)
    Short name:
    AtFUM21 Publication
    Short name:
    Fumarase 21 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:FUM21 Publication
    Ordered Locus Names:At5g50950
    ORF Names:K3K7.11
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

    Organism-specific databases

    Arabidopsis Information Portal

    More...
    Araporti
    AT5G50950

    The Arabidopsis Information Resource

    More...
    TAIRi
    locus:2157413 AT5G50950

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

    Decreased fumarate levels, while malate levels increase (PubMed:20202172). Leaves display lower levels of many amino acids during the day, but higher levels at night, consistent with a link between fumarate and amino acid metabolism (PubMed:20202172). Plants are unable to acclimate photosynthesis in response to cold (PubMed:27440755).2 Publications

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000103301 – 499Fumarate hydratase 2Add BLAST499

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9FI53

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9FI53

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9FI53 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9FI53 AT

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homotetramer.

    1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    20414, 1 interactor

    Protein interaction database and analysis system

    More...
    IntActi
    Q9FI53, 1 interactor

    STRING: functional protein association networks

    More...
    STRINGi
    3702.AT5G50950.1

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9FI53

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni134 – 136Substrate bindingBy similarity3
    Regioni164 – 167Substrate binding (B site)By similarity4
    Regioni174 – 176Substrate bindingBy similarity3
    Regioni359 – 361Substrate bindingBy similarity3

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1317 Eukaryota
    COG0114 LUCA

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000061736

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9FI53

    KEGG Orthology (KO)

    More...
    KOi
    K01679

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    MPRQIIQ

    Database of Orthologous Groups

    More...
    OrthoDBi
    1022919at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9FI53

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd01362 Fumarase_classII, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.10.275.10, 1 hit

    HAMAP database of protein families

    More...
    HAMAPi
    MF_00743 FumaraseC, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR005677 Fum_hydII
    IPR024083 Fumarase/histidase_N
    IPR018951 Fumarase_C_C
    IPR020557 Fumarate_lyase_CS
    IPR000362 Fumarate_lyase_fam
    IPR022761 Fumarate_lyase_N
    IPR008948 L-Aspartase-like

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR11444 PTHR11444, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF10415 FumaraseC_C, 1 hit
    PF00206 Lyase_1, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR00149 FUMRATELYASE

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF48557 SSF48557, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR00979 fumC_II, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00163 FUMARATE_LYASES, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9FI53-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ
    60 70 80 90 100
    VPSDKLWGAQ TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG
    110 120 130 140 150
    LDPMIGEAIM EAAQEVAEGK LNDHFPLVVW QTGSGTQSNM NANEVIANRA
    160 170 180 190 200
    AEILGHKRGE KIVHPNDHVN RSQSSNDTFP TVMHIAAATE ITSRLIPSLK
    210 220 230 240 250
    NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA TQVEYGLNRV
    260 270 280 290 300
    ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF
    310 320 330 340 350
    EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE
    360 370 380 390 400
    PGSSIMPGKV NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI
    410 420 430 440 450
    ASALLHSIRL IADASASFEK NCVRGIEANR ERISKLLHES LMLVTSLNPK
    460 470 480 490
    IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL TSEEFDTLVV PEKMIGPSD
    Length:499
    Mass (Da):54,084
    Last modified:March 1, 2001 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA84422EB032FCB4E
    GO
    Isoform 2 (identifier: Q9FI53-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI

    Note: Derived from EST data. No experimental confirmation available.
    Show »
    Length:510
    Mass (Da):55,766
    Checksum:i4B192A14B3DD12D9
    GO
    Isoform 3 (identifier: Q9FI53-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         210-214: SFEFK → VTHLM
         215-499: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:214
    Mass (Da):23,885
    Checksum:iB56D413A83C88E25
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    A0A1P8BDR1A0A1P8BDR1_ARATH
    FUMARASE 2
    FUM2 FUMARASE 2, At5g50950, K3K7.11, K3K7_11
    408Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B3H477B3H477_ARATH
    FUMARASE 2
    FUM2 FUMARASE 2, At5g50950, K3K7.11, K3K7_11
    317Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011356210 – 214SFEFK → VTHLM in isoform 3. 1 Publication5
    Alternative sequenceiVSP_011357215 – 499Missing in isoform 3. 1 PublicationAdd BLAST285
    Alternative sequenceiVSP_011355472 – 499HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. CuratedAdd BLAST28

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB017063 Genomic DNA Translation: BAB08741.1
    CP002688 Genomic DNA Translation: AED96014.1
    CP002688 Genomic DNA Translation: AED96015.1
    AY052197 mRNA Translation: AAK97668.1
    AY072393 mRNA Translation: AAL62385.1
    AY113070 mRNA Translation: AAM47378.1

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_199908.1, NM_124474.4 [Q9FI53-1]
    NP_851166.1, NM_180835.3 [Q9FI53-2]

    Genome annotation databases

    Ensembl plant genome annotation project

    More...
    EnsemblPlantsi
    AT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
    AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    835168

    Gramene; a comparative resource for plants

    More...
    Gramenei
    AT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
    AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    ath:AT5G50950

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB017063 Genomic DNA Translation: BAB08741.1
    CP002688 Genomic DNA Translation: AED96014.1
    CP002688 Genomic DNA Translation: AED96015.1
    AY052197 mRNA Translation: AAK97668.1
    AY072393 mRNA Translation: AAL62385.1
    AY113070 mRNA Translation: AAM47378.1
    RefSeqiNP_199908.1, NM_124474.4 [Q9FI53-1]
    NP_851166.1, NM_180835.3 [Q9FI53-2]

    3D structure databases

    SMRiQ9FI53
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi20414, 1 interactor
    IntActiQ9FI53, 1 interactor
    STRINGi3702.AT5G50950.1

    Proteomic databases

    PaxDbiQ9FI53
    PRIDEiQ9FI53

    Genome annotation databases

    EnsemblPlantsiAT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
    AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]
    GeneIDi835168
    GrameneiAT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
    AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]
    KEGGiath:AT5G50950

    Organism-specific databases

    AraportiAT5G50950
    TAIRilocus:2157413 AT5G50950

    Phylogenomic databases

    eggNOGiKOG1317 Eukaryota
    COG0114 LUCA
    HOGENOMiHOG000061736
    InParanoidiQ9FI53
    KOiK01679
    OMAiMPRQIIQ
    OrthoDBi1022919at2759
    PhylomeDBiQ9FI53

    Enzyme and pathway databases

    BioCyciARA:AT5G50950-MONOMER
    MetaCyc:AT5G50950-MONOMER
    BRENDAi4.2.1.2 399

    Miscellaneous databases

    Protein Ontology

    More...
    PROi
    PR:Q9FI53

    Gene expression databases

    ExpressionAtlasiQ9FI53 baseline and differential
    GenevisibleiQ9FI53 AT

    Family and domain databases

    CDDicd01362 Fumarase_classII, 1 hit
    Gene3Di1.10.275.10, 1 hit
    HAMAPiMF_00743 FumaraseC, 1 hit
    InterProiView protein in InterPro
    IPR005677 Fum_hydII
    IPR024083 Fumarase/histidase_N
    IPR018951 Fumarase_C_C
    IPR020557 Fumarate_lyase_CS
    IPR000362 Fumarate_lyase_fam
    IPR022761 Fumarate_lyase_N
    IPR008948 L-Aspartase-like
    PANTHERiPTHR11444 PTHR11444, 1 hit
    PfamiView protein in Pfam
    PF10415 FumaraseC_C, 1 hit
    PF00206 Lyase_1, 1 hit
    PRINTSiPR00149 FUMRATELYASE
    SUPFAMiSSF48557 SSF48557, 1 hit
    TIGRFAMsiTIGR00979 fumC_II, 1 hit
    PROSITEiView protein in PROSITE
    PS00163 FUMARATE_LYASES, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFUM2_ARATH
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FI53
    Secondary accession number(s): Q8VY72
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 2003
    Last sequence update: March 1, 2001
    Last modified: September 18, 2019
    This is version 138 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again