Q0P3X7 · CV039_DANRE
- ProteinSynaptic plasticity regulator PANTS
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids108 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Negatively regulates long-term potentiation and modulates adult synaptic plasticity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | synapse | |
Cellular Component | synaptic cleft | |
Biological Process | negative regulation of long-term synaptic potentiation | |
Biological Process | regulation of synaptic plasticity |
Names & Taxonomy
Protein names
- Recommended nameSynaptic plasticity regulator PANTS
- Alternative names
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Actinopterygii (ray-finned fishes) > Actinopteri > Neopterygii > Teleostei (teleost fishes) > Osteoglossocephalai > Clupeocephala > Otomorpha > Ostariophysi > Otophysi > Cypriniphysae > Cypriniformes (carps and others) > Cyprinoidei > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ0P3X7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Detected in both the presynaptic and postsynaptic regions of the synapse and is secreted from neurons into the synaptic cleft. May be released by neuronal dense core vesicles which mediate the release of cleaved neuropeptides.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000326133 | 1-108 | Synaptic plasticity regulator PANTS | |||
Sequence: MAGSQAQWRPPRSCDIYCSELKHCKSLRNRFHEYYTYGRAPDCQQWKQDYQNCKDWEKNHSTQAKDSLQESERKRLADQRKFTPVWELRQKPPSDWHLPLNQGEPQDP |
Post-translational modification
Rapidly degraded by proteolysis following neuronal stimulation, resulting in increased AMPA receptor clustering.
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 58-85 | Basic and acidic residues | ||||
Sequence: KNHSTQAKDSLQESERKRLADQRKFTPV | ||||||
Region | 58-108 | Disordered | ||||
Sequence: KNHSTQAKDSLQESERKRLADQRKFTPVWELRQKPPSDWHLPLNQGEPQDP |
Sequence similarities
Belongs to the UPF0545 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length108
- Mass (Da)13,037
- Last updated2008-03-18 v2
- Checksum63B0AFBC216AAA26
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B0S5C7 | B0S5C7_DANRE | si:ch211-51h9.6 | 108 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 28 | in Ref. 1; AAI46717 | ||||
Sequence: R → S | ||||||
Compositional bias | 58-85 | Basic and acidic residues | ||||
Sequence: KNHSTQAKDSLQESERKRLADQRKFTPV | ||||||
Sequence conflict | 104 | in Ref. 1; AAI46717 | ||||
Sequence: E → K |
Keywords
- Technical term