Q0DU12 · Q0DU12_ORYSJ
- ProteinOs03g0213400 protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1139 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | 3'-5' DNA helicase activity | |
Molecular Function | ATP binding | |
Molecular Function | hydrolase activity | |
Molecular Function | nucleic acid binding |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0DU12
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 347-522 | Helicase ATP-binding | ||||
Sequence: HVLYHSDNNVLLGAPTGSGKTISAELAMLHLFNTQPDMKVVYIAPLKAIVRERMNDWRQRLVTQLGKKMVEMTGDFTPDMMALLSADIIISTPEKWDGISRSWHSRSYVMKVGLMILDEIHLLGADRGPILEVIVSRMRYISSQTERSIRFVGLSTALANARDLADWLGVRDDGLF | ||||||
Domain | 553-763 | Helicase C-terminal | ||||
Sequence: NKPAYAAICTHSPDKPVLIFVSSRRQTRLTALDLIQLAASDEKPRQFLSMADNSLDMILSQVSDTNLRHTLQFGIGLHHAGLNDRDRSLVEELFSNNKIQVLVCTSTLAWGVNLPAHLVIIKGTEYYDGKTKRYIDYDITDILQMMGRAGRPQYDQHGKAVILVHEPKKSFYKKFLYEPFPVESNLREHLHDHINAEIVSGTISNKEEAII |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length1,139
- Mass (Da)130,734
- Last updated2006-10-17 v1
- Checksum4175312A3928CB93
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0VUP0 | A0A0P0VUP0_ORYSJ | Os03g0213400 | 303 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP014959 EMBL· GenBank· DDBJ | BAS82941.1 EMBL· GenBank· DDBJ | Genomic DNA |