P0C174 · KEX11_TITSE
- ProteinPotassium channel toxin epsilon-KTx 1.1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Potassium channel blocker. At 3 uM, this toxin blocks voltage-independently voltage-gated potassium channels rKv1.2/KCNA2 (25%), hKv1.3/KCNA3 (27%), rKv4.2/KCND2 (25%), Kv10.1/KCNH1/EAG1 (15%), Kv11/hERG (12%), and Shaker-IR (10%). On hKv1.3/KCNA3, the IC50 is 17.1 +-3.3 uM.
Miscellaneous
Negative results: does not block all sodium channels tested and several potassium channels. Does not block the following voltage-gated potassium channels: rKv1.1/KCNA1, rKv1.1/KCNA1, rKv1.5/KCNA5, rKv1.6/KCNA6, rKv2.1/KCNB1, hKv3.1/KCNC1, and Kv7.2/KCNQ2. Does not block the following voltage-gated sodium channels: rNav1.1/SCN1A, rNav1.4/SCN4A, hNav1.5/SCN5A, mNav1.6/SCN8A, and DmNav1/para.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | potassium channel regulator activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended namePotassium channel toxin epsilon-KTx 1.1
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Scorpiones > Buthida > Buthoidea > Buthidae > Tityus
Accessions
- Primary accessionP0C174
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for signal, peptide, disulfide bond, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MKLSCGFLLILLVLSAMIATFSEVEAMKPS | ||||||
Peptide | PRO_0000227819 | 31-59 | Potassium channel toxin epsilon-KTx 1.1 | |||
Sequence: KPKCGLCRYRCCSGGCSSGKCVNGACDCS | ||||||
Disulfide bond | 34↔42 | |||||
Sequence: CGLCRYRCC | ||||||
Disulfide bond | 37↔58 | |||||
Sequence: CRYRCCSGGCSSGKCVNGACDC | ||||||
Disulfide bond | 41↔51 | |||||
Sequence: CCSGGCSSGKC | ||||||
Disulfide bond | 46↔56 | |||||
Sequence: CSSGKCVNGAC | ||||||
Propeptide | PRO_0000455731 | 60-72 | ||||
Sequence: GRSDLNDELEKYQ |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Structure
Family & Domains
Domain
The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
Is completely devoid of the classical secondary structure elements (alpha-helix and/or beta-strand).
Sequence similarities
Belongs to the short scorpion toxin superfamily. Potassium channel inhibitor family. Epsilon-KTx 01 subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length72
- Mass (Da)7,721
- Last updated2022-08-03 v2
- Checksum11E25A587EF2FB0E
Sequence caution
Mass Spectrometry
Keywords
- Technical term