C5FYX2 · VPS10_ARTOC
- ProteinVacuolar protein sorting/targeting protein 10
- GeneVPS10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1465 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Functions as a sorting receptor in the Golgi compartment required for the intracellular sorting and delivery of soluble vacuolar proteins, like carboxypeptidase Y (CPY) and proteinase A. Executes multiple rounds of sorting by cycling between the late Golgi and a prevacuolar endosome-like compartment (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | membrane | |
Biological Process | Golgi to endosome transport | |
Biological Process | Golgi to vacuole transport | |
Biological Process | protein targeting to vacuole |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein sorting/targeting protein 10
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Onygenales > Arthrodermataceae > Microsporum
Accessions
- Primary accessionC5FYX2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus, trans-Golgi network membrane ; Multi-pass membrane protein
Prevacuolar compartment membrane ; Multi-pass membrane protein
Note: Cycles between the Golgi apparatus and the prevacuolar compartment.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 24-1336 | Lumenal | ||||
Sequence: KSDEPEIKVKELDKVPTSIYYFEDTDTIIFQKGLGEIYISTDAASSWEVMKDKTGLLWLNRHHTQSACIVGDKRKHWVTYDAAKTWREFEVPDKLILGERIQPFVFHGKDSNKAIINAEECLLTGCRRVTYYTVDGFKTIKKLLQDDSGCYWAVGHPNVGEGLDIRKKIDDRIFCILPGALPFNSSPRLVYSDKFFSDDMAIPVEINGRELRGINKFAFVKKFLVIATVSDGTSEAAIYVSRDAMHWDRAEFYGGPKVREGKFTFLESTNYSIQVNVASRRSKLPIGSLYTSDSTGTSFTMNVDSVNEDKDMYTDFEQVSGIQGIFLINRVDNAEEVKTGKASEKKIVSRISFDDGRTFKPLKYKDKEIHLHSITRPSNSGRTFSSPAPGLVMGVGNSGDRLKEYEHGNLYVSDDAGITWRKALDKAHKYEFGDQGSLLVAIFDEAGGDKIYTDEISYSLNHGKDWKKVKLPHTFLLLAEDKNKKFYVMSIDFSGLHERKCGKNDFERWAARLDEKGEPDCLMGHKQFYRRRKADADCFVKEKFKEPLPEIEPCKCTKEDFECAAGFKRNNDYDCEPDGKLKPSEGQCKKPDDKFMGPSGYRLIPGDDCIKKGGVDLEKEVERACKETSKGPISGKIAVEATPFETEGFQYRYLERSDTSSGDDETVIFKTDKGEIFVSKDHGKSWGRGKFKEPILEFMPHKYDKDVIYLLTGSKKAYWSIDRGHSFHAFEAKMPFTRTLGSLPLFFHPDRPDWLIWIGGEGCSGKKCNDVAYYSKNRGDEWELLLRGVNKCMFVGKEGELTNDDLIFCSQHEGEDPHKDMRLVSSDTMFSKKTSIHFDGKPIAGFTKMSEFIVVATKNGSELQSFTSVDGKTFAHAAFPPNFHVDFEHAYTVLDSSTHSVFLHVTEHAARGHEFGSILKSNSNGTSYVLSLNGANRNVKDYVDFEKIQVVEGVALGNVVFNTEEVKKKNEEKKFRSMITHNDASEWALLPPPKKDVDGHSFGCKVTDKGTNDCALHLHGYTERRDNRDSMSSGSAVGLIIGVGNVGSHLTARAESDTFMSRDAGITWHQIRKGRYQWEFGDQGSIIVIVAEGKPTKVLSYTLDEGETWTDFEFTDAEVTVEDISTVPSDTSKNFLLWTKKGSTTDLVVYNIDFSGLKERERQCVLKKDAPEADDYYLWSPKHPMQKDNCLFGHVSLYHRKKPDAKCYNGPRLDRLSSEKKNCECTRQDYECDYNYERQTDGSCALVKGLKPADPMQICKADPDAVEYFEPTGYRKLPVSTCEGGVQLDHIVARPCPNKKKEFEKKHPGISGL | ||||||
Transmembrane | 1337-1357 | Helical | ||||
Sequence: GLFLAIFFPLATAAAVGYWAF | ||||||
Topological domain | 1358-1383 | Cytoplasmic | ||||
Sequence: SKWDGKFGRIRLGESQPESIFSGDSP | ||||||
Transmembrane | 1384-1404 | Helical | ||||
Sequence: LIAIPVTIVAGTVAVITALPL | ||||||
Topological domain | 1405-1465 | Lumenal | ||||
Sequence: LFSSLWRSVRGYTRLPGRWRQRPYASRGAFAARRGDYVGVVDDEDELLGAEEFEGDEEDEV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MIIRSILLAGSLLLASAIPGTLA | ||||||
Chain | PRO_0000407501 | 24-1465 | Vacuolar protein sorting/targeting protein 10 | |||
Sequence: KSDEPEIKVKELDKVPTSIYYFEDTDTIIFQKGLGEIYISTDAASSWEVMKDKTGLLWLNRHHTQSACIVGDKRKHWVTYDAAKTWREFEVPDKLILGERIQPFVFHGKDSNKAIINAEECLLTGCRRVTYYTVDGFKTIKKLLQDDSGCYWAVGHPNVGEGLDIRKKIDDRIFCILPGALPFNSSPRLVYSDKFFSDDMAIPVEINGRELRGINKFAFVKKFLVIATVSDGTSEAAIYVSRDAMHWDRAEFYGGPKVREGKFTFLESTNYSIQVNVASRRSKLPIGSLYTSDSTGTSFTMNVDSVNEDKDMYTDFEQVSGIQGIFLINRVDNAEEVKTGKASEKKIVSRISFDDGRTFKPLKYKDKEIHLHSITRPSNSGRTFSSPAPGLVMGVGNSGDRLKEYEHGNLYVSDDAGITWRKALDKAHKYEFGDQGSLLVAIFDEAGGDKIYTDEISYSLNHGKDWKKVKLPHTFLLLAEDKNKKFYVMSIDFSGLHERKCGKNDFERWAARLDEKGEPDCLMGHKQFYRRRKADADCFVKEKFKEPLPEIEPCKCTKEDFECAAGFKRNNDYDCEPDGKLKPSEGQCKKPDDKFMGPSGYRLIPGDDCIKKGGVDLEKEVERACKETSKGPISGKIAVEATPFETEGFQYRYLERSDTSSGDDETVIFKTDKGEIFVSKDHGKSWGRGKFKEPILEFMPHKYDKDVIYLLTGSKKAYWSIDRGHSFHAFEAKMPFTRTLGSLPLFFHPDRPDWLIWIGGEGCSGKKCNDVAYYSKNRGDEWELLLRGVNKCMFVGKEGELTNDDLIFCSQHEGEDPHKDMRLVSSDTMFSKKTSIHFDGKPIAGFTKMSEFIVVATKNGSELQSFTSVDGKTFAHAAFPPNFHVDFEHAYTVLDSSTHSVFLHVTEHAARGHEFGSILKSNSNGTSYVLSLNGANRNVKDYVDFEKIQVVEGVALGNVVFNTEEVKKKNEEKKFRSMITHNDASEWALLPPPKKDVDGHSFGCKVTDKGTNDCALHLHGYTERRDNRDSMSSGSAVGLIIGVGNVGSHLTARAESDTFMSRDAGITWHQIRKGRYQWEFGDQGSIIVIVAEGKPTKVLSYTLDEGETWTDFEFTDAEVTVEDISTVPSDTSKNFLLWTKKGSTTDLVVYNIDFSGLKERERQCVLKKDAPEADDYYLWSPKHPMQKDNCLFGHVSLYHRKKPDAKCYNGPRLDRLSSEKKNCECTRQDYECDYNYERQTDGSCALVKGLKPADPMQICKADPDAVEYFEPTGYRKLPVSTCEGGVQLDHIVARPCPNKKKEFEKKHPGISGLGLFLAIFFPLATAAAVGYWAFSKWDGKFGRIRLGESQPESIFSGDSPLIAIPVTIVAGTVAVITALPLLFSSLWRSVRGYTRLPGRWRQRPYASRGAFAARRGDYVGVVDDEDELLGAEEFEGDEEDEV | ||||||
Glycosylation | 293 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 882 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 947 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 374-383 | BNR 1 | ||||
Sequence: ISFDDGRTFK | ||||||
Repeat | 434-444 | BNR 2 | ||||
Sequence: YVSDDAGITWR | ||||||
Repeat | 481-491 | BNR 3 | ||||
Sequence: YSLNHGKDWKK | ||||||
Repeat | 700-709 | BNR 4 | ||||
Sequence: FVSKDHGKSW | ||||||
Repeat | 1082-1092 | BNR 5 | ||||
Sequence: FMSRDAGITWH | ||||||
Repeat | 1124-1133 | BNR 6 | ||||
Sequence: YTLDEGETWT |
Sequence similarities
Belongs to the VPS10-related sortilin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length1,465
- Mass (Da)164,786
- Last updated2011-05-03 v2
- ChecksumD047E2E72DACAFDD
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS995707 EMBL· GenBank· DDBJ | EEQ34720.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. |