B0YA89 · VPS10_ASPFC
- ProteinVacuolar protein sorting/targeting protein 10
- Genevps10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1487 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Functions as a sorting receptor in the Golgi compartment required for the intracellular sorting and delivery of soluble vacuolar proteins, like carboxypeptidase Y (CPY) and proteinase A. Executes multiple rounds of sorting by cycling between the late Golgi and a prevacuolar endosome-like compartment (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | membrane | |
Biological Process | Golgi to endosome transport | |
Biological Process | Golgi to vacuole transport | |
Biological Process | protein targeting to vacuole |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein sorting/targeting protein 10
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Aspergillus > Aspergillus subgen. Fumigati
Accessions
- Primary accessionB0YA89
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus, trans-Golgi network membrane ; Multi-pass membrane protein
Prevacuolar compartment membrane ; Multi-pass membrane protein
Note: Cycles between the Golgi apparatus and the prevacuolar compartment.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-1356 | Lumenal | ||||
Sequence: AKKSEPEITSSSFDNEPFSLSYFEDTETILMNTRDGNLFRSFDGGKAWEQVDGPDGKMKKAVRSIWQHPFDKNKAYALGANRRHWVTKDQAKTWESFEVDGYAAAQHEPLIFHGWDSAKVIFQSDECMGRLCIVKSYYTTDDFKTVSPLRVSAGGCLWAVGHPQFADGLNLEDELRDRVLCIVPGLKVPSAHANRLVYSDDFFRSDAEGTELNIQHGRPVSGILSAAAVKKFFVTAAKSQGTNELALYVTLDTKAWHRADFGGHRVEQDGYTLLESTNYSMQVDVLTSPSSNTGVLFTSNSNGTYFTRNVEHTNRDRFGHVDFEKIADIQGIVLVNTVKNWDKVESENEKKVVSSISFDDGRTFQSLKVGDKQLHLHSVTTFANTGRVFSSPAPGLVMGVGNTGDHLKKYSEGSLYVSDDAGVTWRHALDGPFKYEFGDQGSVIMAVSDKGTTDEIQFSIDHGKEWHSTKLQHKINPKLLTTTPDSTSLTFLLVGSEESSGTKHVVYSIDFHGLHERKCEKDDFEKWAARLNENGEPDCLMGHQQFFNRRKANADCFVDEEFKDPQPIFEPCKCSFEDFECDFNFVRSEDGKSCVPTAPLVPPVGRCQKQTDTFMGPSGWRLIPGNTCTREGGENLDKVVERPCKDVVSAPSHDKPMAQKQVFNDARQFSEQYYYLERQASSSGDDETVIMLTSEGEFWVSHDHGKNWEQPLKGVKIAAIVPHPYYSDGAFLLTRDKQAFWTVDRAYTFKSFEAPIPPNQEGLPVLSFHPHYKDWLIWTGAVDCSHGDCHSDAYFSKNRGENWDLLLRYVGKCEFESRENRPGSEKLIFCQQYENENKKNHLQLLSSENLFSDSHVHFNDAIRYATMSEYIIVASRDPDNPDSLIASVSVDGKTFARAEFPSNVDVPVKTAFTVLDSSTHAVFLHVTVSDVKGAEYGSIIKSNSNGTSYVLSLNAASRNEWGYVDFEKMQGLEGVAVVNIISNVDAVQKKGPAAKKLKTMITHNDGGQWMLLPPPAKDADGKNFGCSVKDGKGSDQCSLHLHGYTERRDPRDTFSSGSAIGLMMGIGNVGAYLSGKDEADTFMTRDGGITWKSVKKGRYMWEYGDAGSVIVIVPELRPTKVLYYSLDEGDNWEPYEFSEVEMHIYRLSTVPSDTSKNFLLWGKEMESNRLATINVDFSGLRKKSCILVEDGQESDDYYLWEPKHPFQEDNCLFGHVEQYHRKKPSSQCWNNWREPHVHSIGRNCTCTRADYECNYNYEPQNDGSCALVPGLPKPDALAVCREDPDRVEYWEPTAYRRIPQTTCSGGLILDHVVSKPCPSKEKEYEKKHGISGTG | ||||||
Transmembrane | 1357-1377 | Helical | ||||
Sequence: LFFAIMIPLVAAAGVGYYVYA | ||||||
Topological domain | 1378-1409 | Cytoplasmic | ||||
Sequence: RWDGKFGQIRLGENAGTYEGLLSRESPIVTAP | ||||||
Transmembrane | 1410-1430 | Helical | ||||
Sequence: IAIIAGIVAVIRALPLLAMSL | ||||||
Topological domain | 1431-1487 | Lumenal | ||||
Sequence: WRSASGYVRLGRNRAYSRPYASRGSFAARRGDYTSVVDDEDELLGVDDAEIDDDDEL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MITRWLLITSFLALAILSLSSA | ||||||
Chain | PRO_0000407504 | 23-1487 | Vacuolar protein sorting/targeting protein 10 | |||
Sequence: AKKSEPEITSSSFDNEPFSLSYFEDTETILMNTRDGNLFRSFDGGKAWEQVDGPDGKMKKAVRSIWQHPFDKNKAYALGANRRHWVTKDQAKTWESFEVDGYAAAQHEPLIFHGWDSAKVIFQSDECMGRLCIVKSYYTTDDFKTVSPLRVSAGGCLWAVGHPQFADGLNLEDELRDRVLCIVPGLKVPSAHANRLVYSDDFFRSDAEGTELNIQHGRPVSGILSAAAVKKFFVTAAKSQGTNELALYVTLDTKAWHRADFGGHRVEQDGYTLLESTNYSMQVDVLTSPSSNTGVLFTSNSNGTYFTRNVEHTNRDRFGHVDFEKIADIQGIVLVNTVKNWDKVESENEKKVVSSISFDDGRTFQSLKVGDKQLHLHSVTTFANTGRVFSSPAPGLVMGVGNTGDHLKKYSEGSLYVSDDAGVTWRHALDGPFKYEFGDQGSVIMAVSDKGTTDEIQFSIDHGKEWHSTKLQHKINPKLLTTTPDSTSLTFLLVGSEESSGTKHVVYSIDFHGLHERKCEKDDFEKWAARLNENGEPDCLMGHQQFFNRRKANADCFVDEEFKDPQPIFEPCKCSFEDFECDFNFVRSEDGKSCVPTAPLVPPVGRCQKQTDTFMGPSGWRLIPGNTCTREGGENLDKVVERPCKDVVSAPSHDKPMAQKQVFNDARQFSEQYYYLERQASSSGDDETVIMLTSEGEFWVSHDHGKNWEQPLKGVKIAAIVPHPYYSDGAFLLTRDKQAFWTVDRAYTFKSFEAPIPPNQEGLPVLSFHPHYKDWLIWTGAVDCSHGDCHSDAYFSKNRGENWDLLLRYVGKCEFESRENRPGSEKLIFCQQYENENKKNHLQLLSSENLFSDSHVHFNDAIRYATMSEYIIVASRDPDNPDSLIASVSVDGKTFARAEFPSNVDVPVKTAFTVLDSSTHAVFLHVTVSDVKGAEYGSIIKSNSNGTSYVLSLNAASRNEWGYVDFEKMQGLEGVAVVNIISNVDAVQKKGPAAKKLKTMITHNDGGQWMLLPPPAKDADGKNFGCSVKDGKGSDQCSLHLHGYTERRDPRDTFSSGSAIGLMMGIGNVGAYLSGKDEADTFMTRDGGITWKSVKKGRYMWEYGDAGSVIVIVPELRPTKVLYYSLDEGDNWEPYEFSEVEMHIYRLSTVPSDTSKNFLLWGKEMESNRLATINVDFSGLRKKSCILVEDGQESDDYYLWEPKHPFQEDNCLFGHVEQYHRKKPSSQCWNNWREPHVHSIGRNCTCTRADYECNYNYEPQNDGSCALVPGLPKPDALAVCREDPDRVEYWEPTAYRRIPQTTCSGGLILDHVVSKPCPSKEKEYEKKHGISGTGLFFAIMIPLVAAAGVGYYVYARWDGKFGQIRLGENAGTYEGLLSRESPIVTAPIAIIAGIVAVIRALPLLAMSLWRSASGYVRLGRNRAYSRPYASRGSFAARRGDYTSVVDDEDELLGVDDAEIDDDDEL | ||||||
Glycosylation | 300 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 324 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 967 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1265 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 61-71 | BNR 1 | ||||
Sequence: FRSFDGGKAWE | ||||||
Repeat | 378-387 | BNR 2 | ||||
Sequence: ISFDDGRTFQ | ||||||
Repeat | 438-448 | BNR 3 | ||||
Sequence: YVSDDAGVTWR | ||||||
Repeat | 479-489 | BNR 4 | ||||
Sequence: QFSIDHGKEWH | ||||||
Repeat | 721-731 | BNR 5 | ||||
Sequence: WVSHDHGKNWE | ||||||
Repeat | 816-826 | BNR 6 | ||||
Sequence: YFSKNRGENWD | ||||||
Repeat | 1104-1114 | BNR 7 | ||||
Sequence: FMTRDGGITWK | ||||||
Repeat | 1145-1155 | BNR 8 | ||||
Sequence: YYSLDEGDNWE |
Sequence similarities
Belongs to the VPS10-related sortilin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length1,487
- Mass (Da)166,459
- Last updated2008-04-08 v1
- ChecksumB89476E2092F5D29
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS499600 EMBL· GenBank· DDBJ | EDP48932.1 EMBL· GenBank· DDBJ | Genomic DNA |