A9LYH4 · RR2_ACOCI
- ProteinSmall ribosomal subunit protein uS2c
- Generps2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids236 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | mitochondrial small ribosomal subunit | |
Molecular Function | structural constituent of ribosome | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein uS2c
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Acoraceae > Acorus
Accessions
- Primary accessionA9LYH4
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000352084 | 1-236 | Small ribosomal subunit protein uS2c | |||
Sequence: MTKRYWNINLEEMMEAGVHFGHGTRKWNPRMAPYISAKRKGIHITNLTRTARFLSEACDLLFDAASGGKHFLIVGTKKKAADSVASAAIRARCHYVNKKWLGGMSTNWSTTETRLQNFRDLRAEQKAGKIDRLPKRDAAMLKRQLSTLQTYLGGIKYMTGLPDIVIIVDQQEDYTALRECVILGIPTICLIDTNSDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNR |
Structure
Sequence
- Sequence statusComplete
- Length236
- Mass (Da)26,531
- Last updated2008-02-05 v1
- ChecksumACB74E9AA9F8E0E8
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU273602 EMBL· GenBank· DDBJ | ABX38733.1 EMBL· GenBank· DDBJ | Genomic DNA |