A2VEC9 · SSPO_HUMAN
- ProteinSCO-spondin
- GeneSSPOP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids5150 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Involved in the modulation of neuronal aggregation (By similarity).
May be involved in developmental events during the formation of the central nervous system (By similarity).
May be involved in developmental events during the formation of the central nervous system (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular matrix | |
Cellular Component | extracellular space | |
Cellular Component | plasma membrane protein complex | |
Molecular Function | peptidase inhibitor activity | |
Biological Process | cell adhesion |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSCO-spondin
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA2VEC9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Natural variant | VAR_052660 | 146 | in dbSNP:rs709061 | ||
Natural variant | VAR_052661 | 298 | in dbSNP:rs17754559 | ||
Natural variant | VAR_059863 | 540 | in dbSNP:rs855677 | ||
Natural variant | VAR_075709 | 1002 | found in patient with Joubert syndrome; uncertain significance; dbSNP:rs199648588 | ||
Natural variant | VAR_059864 | 1273 | in dbSNP:rs709060 | ||
Natural variant | VAR_052662 | 1274 | in dbSNP:rs709060 | ||
Natural variant | VAR_059865 | 1425 | in dbSNP:rs855691 | ||
Natural variant | VAR_059866 | 1449 | in dbSNP:rs855692 | ||
Natural variant | VAR_059867 | 1454 | in dbSNP:rs2074704 | ||
Natural variant | VAR_059868 | 1779 | in dbSNP:rs893601 | ||
Natural variant | VAR_059869 | 1794 | in dbSNP:rs1635802 | ||
Natural variant | VAR_059870 | 1883 | in dbSNP:rs1076277 | ||
Natural variant | VAR_059871 | 2018 | in dbSNP:rs4725314 | ||
Natural variant | VAR_061915 | 2453 | in dbSNP:rs2074689 | ||
Natural variant | VAR_061916 | 2542 | in dbSNP:rs59522380 | ||
Natural variant | VAR_075710 | 2799 | found in patient with Joubert syndrome; uncertain significance; dbSNP:rs181269877 | ||
Natural variant | VAR_059872 | 2892 | in dbSNP:rs10260959 | ||
Natural variant | VAR_059873 | 3274 | in dbSNP:rs740109 | ||
Natural variant | VAR_059874 | 3513 | in dbSNP:rs10952230 | ||
Natural variant | VAR_059875 | 3894 | in dbSNP:rs1557955 | ||
Natural variant | VAR_059876 | 3911 | in dbSNP:rs745044 | ||
Natural variant | VAR_059877 | 4030 | in dbSNP:rs1005603 | ||
Natural variant | VAR_061917 | 4109 | in dbSNP:rs12536873 | ||
Natural variant | VAR_059878 | 4166 | in dbSNP:rs10233245 | ||
Natural variant | VAR_059879 | 4332 | in dbSNP:rs1008336 | ||
Natural variant | VAR_059880 | 4790 | in dbSNP:rs1004200 | ||
Natural variant | VAR_059881 | 4944 | in dbSNP:rs12534509 | ||
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 27 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Signal | 1-17 | ||||
Chain | PRO_5000223757 | 18-5150 | SCO-spondin | ||
Glycosylation | 88 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 130 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 195↔323 | ||||
Disulfide bond | 217↔361 | ||||
Disulfide bond | 239↔245 | ||||
Glycosylation | 261 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 515 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 565↔698 | ||||
Disulfide bond | 589↔735 | ||||
Glycosylation | 820 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 912 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 945 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 987 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 1015↔1147 | ||||
Disulfide bond | 1037↔1182 | ||||
Disulfide bond | 1058↔1065 | ||||
Glycosylation | 1353 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 1377↔1390 | ||||
Disulfide bond | 1384↔1403 | ||||
Disulfide bond | 1397↔1412 | ||||
Disulfide bond | 1417↔1429 | ||||
Disulfide bond | 1424↔1442 | ||||
Disulfide bond | 1436↔1453 | ||||
Disulfide bond | 1453↔1465 | ||||
Disulfide bond | 1460↔1478 | ||||
Disulfide bond | 1472↔1487 | ||||
Disulfide bond | 1493↔1505 | ||||
Disulfide bond | 1500↔1518 | ||||
Disulfide bond | 1512↔1529 | ||||
Disulfide bond | 1566↔1578 | ||||
Disulfide bond | 1573↔1591 | ||||
Disulfide bond | 1585↔1600 | ||||
Disulfide bond | 1604↔1617 | ||||
Disulfide bond | 1611↔1630 | ||||
Disulfide bond | 1624↔1641 | ||||
Glycosylation | 1651 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 1657↔1667 | ||||
Disulfide bond | 1662↔1680 | ||||
Glycosylation | 1664 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 1674↔1695 | ||||
Disulfide bond | 1707↔1743 | ||||
Disulfide bond | 1711↔1748 | ||||
Disulfide bond | 1722↔1733 | ||||
Disulfide bond | 1763↔1803 | ||||
Disulfide bond | 1767↔1808 | ||||
Disulfide bond | 1777↔1787 | ||||
Glycosylation | 1810 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 1911↔1950 | ||||
Disulfide bond | 1922↔1926 | ||||
Disulfide bond | 1960↔1965 | ||||
Glycosylation | 1994 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 2031 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 2066↔2225 | ||||
Glycosylation | 2134 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 2235↔2247 | ||||
Disulfide bond | 2242↔2260 | ||||
Disulfide bond | 2254↔2269 | ||||
Disulfide bond | 2392↔2404 | ||||
Disulfide bond | 2399↔2417 | ||||
Disulfide bond | 2411↔2426 | ||||
Disulfide bond | 2465↔2477 | ||||
Disulfide bond | 2472↔2490 | ||||
Disulfide bond | 2484↔2499 | ||||
Disulfide bond | 2502↔2538 | ||||
Disulfide bond | 2513↔2517 | ||||
Disulfide bond | 2548↔2553 | ||||
Disulfide bond | 2568↔2605 | ||||
Disulfide bond | 2572↔2610 | ||||
Disulfide bond | 2583↔2595 | ||||
Glycosylation | 2646 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 2695 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 2717↔2755 | ||||
Disulfide bond | 2728↔2732 | ||||
Disulfide bond | 2765↔2769 | ||||
Disulfide bond | 2785↔2823 | ||||
Disulfide bond | 2789↔2828 | ||||
Disulfide bond | 2805↔2813 | ||||
Disulfide bond | 2843↔2878 | ||||
Disulfide bond | 2847↔2883 | ||||
Disulfide bond | 2858↔2868 | ||||
Glycosylation | 2937 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 2968 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 2987↔3025 | ||||
Disulfide bond | 2998↔3002 | ||||
Disulfide bond | 3035↔3040 | ||||
Glycosylation | 3063 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3117 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3164 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3174 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 3196↔3245 | ||||
Disulfide bond | 3200↔3250 | ||||
Disulfide bond | 3211↔3235 | ||||
Disulfide bond | 3265↔3302 | ||||
Disulfide bond | 3269↔3307 | ||||
Disulfide bond | 3280↔3292 | ||||
Glycosylation | 3311 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3400 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 3421↔3464 | ||||
Disulfide bond | 3425↔3470 | ||||
Disulfide bond | 3436↔3448 | ||||
Disulfide bond | 3485↔3520 | ||||
Disulfide bond | 3488↔3527 | ||||
Disulfide bond | 3498↔3510 | ||||
Glycosylation | 3513 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3523 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3600 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3627 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 3658↔3688 | ||||
Disulfide bond | 3662↔3693 | ||||
Disulfide bond | 3673↔3678 | ||||
Glycosylation | 3793 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 3824↔3862 | ||||
Disulfide bond | 3828↔3867 | ||||
Disulfide bond | 3840↔3852 | ||||
Glycosylation | 3916 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 3948 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 3949↔3985 | ||||
Disulfide bond | 3960↔3964 | ||||
Disulfide bond | 3998↔4003 | ||||
Disulfide bond | 4018↔4055 | ||||
Disulfide bond | 4022↔4060 | ||||
Disulfide bond | 4033↔4045 | ||||
Glycosylation | 4141 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 4162↔4198 | ||||
Disulfide bond | 4173↔4177 | ||||
Disulfide bond | 4208↔4213 | ||||
Glycosylation | 4348 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 4368↔4405 | ||||
Disulfide bond | 4379↔4381 | ||||
Disulfide bond | 4415↔4420 | ||||
Glycosylation | 4419 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4734 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4751 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4756 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 4778↔4813 | ||||
Disulfide bond | 4782↔4818 | ||||
Disulfide bond | 4793↔4802 | ||||
Glycosylation | 4866 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4906 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4951 | N-linked (GlcNAc...) asparagine | |||
Glycosylation | 4958 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 5044↔5104 | ||||
Glycosylation | 5064 | N-linked (GlcNAc...) asparagine | |||
Disulfide bond | 5070↔5121 | ||||
Disulfide bond | 5080↔5137 | ||||
Disulfide bond | 5084↔5139 | ||||
Keywords
- PTM
Proteomic databases
PTM databases
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Domain | 18-102 | EMI | |||
Domain | 193-362 | VWFD 1 | |||
Domain | 470-525 | TIL 1 | |||
Domain | 563-736 | VWFD 2 | |||
Domain | 828-881 | TIL 2 | |||
Domain | 881-940 | VWFC 1 | |||
Domain | 924-975 | TIL 3 | |||
Domain | 1013-1183 | VWFD 3 | |||
Domain | 1276-1332 | TIL 4 | |||
Domain | 1376-1413 | LDL-receptor class A 1 | |||
Domain | 1416-1451 | LDL-receptor class A 2 | |||
Domain | 1452-1488 | LDL-receptor class A 3 | |||
Domain | 1492-1530 | LDL-receptor class A 4 | |||
Region | 1529-1561 | Disordered | |||
Compositional bias | 1530-1544 | Pro residues | |||
Compositional bias | 1545-1559 | Polar residues | |||
Domain | 1565-1601 | LDL-receptor class A 5 | |||
Domain | 1603-1642 | LDL-receptor class A 6 | |||
Domain | 1656-1694 | LDL-receptor class A 7 | |||
Domain | 1695-1749 | TSP type-1 1 | |||
Domain | 1751-1809 | TSP type-1 2 | |||
Domain | 1825-1864 | EGF-like 1 | |||
Domain | 1865-1902 | EGF-like 2 | |||
Domain | 1910-1966 | TSP type-1 3 | |||
Domain | 1966-2026 | VWFC 2 | |||
Domain | 2066-2225 | F5/8 type C | |||
Domain | 2234-2270 | LDL-receptor class A 8 | |||
Region | 2306-2338 | Disordered | |||
Compositional bias | 2312-2326 | Polar residues | |||
Domain | 2391-2427 | LDL-receptor class A 9 | |||
Domain | 2464-2500 | LDL-receptor class A 10 | |||
Domain | 2501-2554 | TSP type-1 4 | |||
Domain | 2556-2611 | TSP type-1 5 | |||
Domain | 2633-2676 | TIL 5 | |||
Domain | 2716-2770 | TSP type-1 6 | |||
Domain | 2773-2829 | TSP type-1 7 | |||
Domain | 2831-2884 | TSP type-1 8 | |||
Domain | 2986-3041 | TSP type-1 9 | |||
Domain | 3042-3084 | TSP type-1 10 | |||
Domain | 3091-3143 | TIL 6 | |||
Domain | 3184-3251 | TSP type-1 11 | |||
Domain | 3253-3308 | TSP type-1 12 | |||
Domain | 3316-3366 | TIL 7 | |||
Domain | 3409-3471 | TSP type-1 13 | |||
Domain | 3473-3528 | TSP type-1 14 | |||
Region | 3499-3520 | Disordered | |||
Domain | 3530-3586 | TIL 8 | |||
Domain | 3646-3694 | TSP type-1 15 | |||
Domain | 3812-3868 | TSP type-1 16 | |||
Domain | 3882-3934 | TSP type-1 17 | |||
Domain | 3948-4004 | TSP type-1 18 | |||
Domain | 4006-4061 | TSP type-1 19 | |||
Domain | 4064-4119 | TIL 9 | |||
Domain | 4161-4214 | TSP type-1 20 | |||
Domain | 4255-4307 | TSP type-1 21 | |||
Domain | 4309-4365 | TSP type-1 22 | |||
Domain | 4367-4421 | TSP type-1 23 | |||
Domain | 4425-4480 | TIL 10 | |||
Domain | 4617-4667 | TSP type-1 24 | |||
Domain | 4678-4726 | TIL 11 | |||
Domain | 4766-4819 | TSP type-1 25 | |||
Domain | 4821-4875 | TIL 12 | |||
Domain | 4987-5045 | VWFC 3 | |||
Domain | 5044-5143 | CTCK | |||
Sequence similarities
Belongs to the thrombospondin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
A2VEC9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length5,150
- Mass (Da)547,841
- Last updated2018-03-28 v2
- MD5 Checksum61E4F2E3BF87B2FD67D4C7DA78194BCE
A2VEC9-2
- Name2
- Differences from canonical
- 1-1123: Missing
- 1124-1127: LWDG → MLPP
- 1640-1640: A → ACVEAPAPPAMRGPPGQAGGPTSSRAPSPPSPPEAQGEGRKGQERSRTHLTVPAGSTQLPLCPGLFPCGVAPGLCLTPEQLCDGIPDCPQGEDELD
- 1672-1672: L → LVRVGVGGGGGSAMLPPSTRALTPLPPQ
- 2180-2315: LFPRNWDDLDPAVWTFGRMVQARFVRVWPHDVHHSDVPLQVELLGCEPGSPPAPLCPGVGLRCASGECVLRGGPCDGVLDCEDGSDEEGCVLLPEGTGRFHSTAKTLALSSAQPGQLLHWPREGLAETEHWPPGQE → VSPAQGRWGQQPTMPFCGFHSLCPQGPSSVPEGHGLHSMLVEYLVSSRDCALWSRGLGATVTWMLETIQVAQTQGRYVKPARERGWGDTKFTEGLREPRPTHVFVESSLGTALPSGGLHPSRRQTARSGRNQSVLC
- 2316-5147: Missing
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | ||
---|---|---|---|---|---|
Alternative sequence | VSP_035258 | 1-1123 | in isoform 2 | ||
Alternative sequence | VSP_035259 | 1124-1127 | in isoform 2 | ||
Compositional bias | 1530-1544 | Pro residues | |||
Compositional bias | 1545-1559 | Polar residues | |||
Alternative sequence | VSP_035260 | 1640 | in isoform 2 | ||
Alternative sequence | VSP_035261 | 1672 | in isoform 2 | ||
Alternative sequence | VSP_035262 | 2180-2315 | in isoform 2 | ||
Compositional bias | 2312-2326 | Polar residues | |||
Alternative sequence | VSP_035263 | 2316-5147 | in isoform 2 | ||
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB111888 EMBL· GenBank· DDBJ | BAC98376.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AC004877 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF459635 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF495712 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF459640 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BN000852 EMBL· GenBank· DDBJ | CAJ43920.1 EMBL· GenBank· DDBJ | mRNA |