A0A7N2MX35 · A0A7N2MX35_QUELO
- ProteinXyloglucan endotransglucosylase/hydrolase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids267 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 81 | Nucleophile | ||||
Sequence: E | ||||||
Active site | 85 | Proton donor | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Molecular Function | hydrolase activity, hydrolyzing O-glycosyl compounds | |
Molecular Function | xyloglucan:xyloglucosyl transferase activity | |
Biological Process | cell wall biogenesis | |
Biological Process | cell wall organization | |
Biological Process | xyloglucan metabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameXyloglucan endotransglucosylase/hydrolase
- EC number
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fagales > Fagaceae > Quercus
Accessions
- Primary accessionA0A7N2MX35
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Post-translational modification
Contains at least one intrachain disulfide bond essential for its enzymatic activity.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-195 | GH16 | ||||
Sequence: MQVRELYQDFIIEYSPNHVYTSPNGRFRTLSLDHDSGSGFTSKVKLLFGQFDMQIKLVPGRSAGTVVAFYLKSGDSNNRDEVDFEFLGNVIGKPYGLQTNIFSDGSGNREQRIHLWFDPTKDFHTYSILWNIYLIMFMVDGIPIRVYRNHADKGVQYPQWKPMNLVASIWNGEGWATRGGKDKIDWSKAPFIASF |
Sequence similarities
Belongs to the glycosyl hydrolase 16 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length267
- Mass (Da)31,260
- Last updated2021-04-07 v1
- ChecksumDBBC7F60A37E26DA
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LRBV02000011 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |