A0A6J5U2H5 · A0A6J5U2H5_PRUAR
- ProteinGATA transcription factor
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids251 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | cell differentiation | |
Biological Process | positive regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameGATA transcription factor
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Rosales > Rosaceae > Amygdaloideae > Amygdaleae > Prunus
Accessions
- Primary accessionA0A6J5U2H5
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 31-65 | Disordered | ||||
Sequence: DDLFSSSTSSTDSIDLHPPPPPPHPHVSSTPFNPT | ||||||
Compositional bias | 45-59 | Pro residues | ||||
Sequence: DLHPPPPPPHPHVSS | ||||||
Region | 114-175 | Disordered | ||||
Sequence: SSLFPSRVRTNRTKWGGPPEPSDSRAKPKREPSEASPSPSKPRRCAHCASEKTPQWRAGPMG | ||||||
Compositional bias | 136-150 | Basic and acidic residues | ||||
Sequence: DSRAKPKREPSEASP | ||||||
Domain | 152-188 | GATA-type | ||||
Sequence: PSKPRRCAHCASEKTPQWRAGPMGPKTLCNACGVRFK | ||||||
Region | 221-240 | Disordered | ||||
Sequence: RQKEASEQQQPEGQQQQKQQ |
Sequence similarities
Belongs to the type IV zinc-finger family. Class A subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length251
- Mass (Da)27,881
- Last updated2020-10-07 v1
- Checksum98302C9E7B97CFBA
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 45-59 | Pro residues | ||||
Sequence: DLHPPPPPPHPHVSS | ||||||
Compositional bias | 136-150 | Basic and acidic residues | ||||
Sequence: DSRAKPKREPSEASP |