A0A455B742 · A0A455B742_PHYMC
- ProteinSodium/potassium-transporting ATPase subunit alpha
- GeneATP1A1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids992 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients (By similarity).
Could also be part of an osmosensory signaling pathway that senses body-fluid sodium levels and controls salt intake behavior as well as voluntary water intake to regulate sodium homeostasis
Could also be part of an osmosensory signaling pathway that senses body-fluid sodium levels and controls salt intake behavior as well as voluntary water intake to regulate sodium homeostasis
Catalytic activity
- ATP + H2O + K+(out) + Na+(in) = ADP + H+ + K+(in) + Na+(out) + phosphate
CHEBI:30616 + CHEBI:15377 + K+ (out)CHEBI:29103+ Na+ (in)CHEBI:29101= CHEBI:456216 + CHEBI:15378 + K+ (in)CHEBI:29103+ Na+ (out)CHEBI:29101+ CHEBI:43474
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | lateral plasma membrane | |
Cellular Component | melanosome | |
Cellular Component | sarcolemma | |
Cellular Component | sodium:potassium-exchanging ATPase complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | metal ion binding | |
Molecular Function | P-type sodium:potassium-exchanging transporter activity | |
Biological Process | intracellular potassium ion homeostasis | |
Biological Process | intracellular sodium ion homeostasis | |
Biological Process | potassium ion import across plasma membrane | |
Biological Process | proton transmembrane transport | |
Biological Process | sodium ion export across plasma membrane |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSodium/potassium-transporting ATPase subunit alpha
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Whippomorpha > Cetacea > Odontoceti > Physeteridae > Physeter
Accessions
- Primary accessionA0A455B742
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Basolateral cell membrane ; Multi-pass membrane protein
Cell membrane, sarcolemma ; Multi-pass membrane protein
Cell membrane ; Multi-pass membrane protein
Lateral cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 65-87 | Helical | ||||
Sequence: LFGGFSMLLWIGAILCFLAYGIQ | ||||||
Transmembrane | 99-118 | Helical | ||||
Sequence: LYLGVVLSAVVIITGCFSYY | ||||||
Transmembrane | 260-284 | Helical | ||||
Sequence: FIHIITGVAVFLGVSFFILSLILEY | ||||||
Transmembrane | 290-313 | Helical | ||||
Sequence: VIFLIGIIVANVPEGLLATVTVCL | ||||||
Transmembrane | 822-843 | Helical | ||||
Sequence: AYGQIGMIQALGGFFTYFVIMA | ||||||
Transmembrane | 882-901 | Helical | ||||
Sequence: IVEFTCHTAFFVSIVVVQWA | ||||||
Transmembrane | 922-949 | Helical | ||||
Sequence: ILIFGLFEETALAAFLSYCPGMGVALRM | ||||||
Transmembrane | 955-973 | Helical | ||||
Sequence: TWWFCAFPYSLLIFVYDEV |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-85 | Cation-transporting P-type ATPase N-terminal | ||||
Sequence: DDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYG | ||||||
Region | 185-204 | Disordered | ||||
Sequence: SSLTGESEPQTRSPDFTNEN |
Sequence similarities
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length992
- Mass (Da)109,532
- Last updated2019-06-05 v1
- Checksum6E657AFF25A39127
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2Y9SI68 | A0A2Y9SI68_PHYMC | ATP1A1 | 1021 | ||
A0A455BLK4 | A0A455BLK4_PHYMC | ATP1A1 | 554 |
Keywords
- Technical term