A0A452XB12 · A0A452XB12_AEGTS

Function

GO annotations

all annotationsall molecular functionnucleotide bindingmolecular_functionnucleic acid bindingdna bindingchromatin bindingdna-binding transcription factor activityrna bindingcytoskeletal motor activitycatalytic activitynuclease activitysignaling receptor bindingstructural molecule activitytransporter activitybindingprotein bindingtranslation factor activity, rna bindinglipid bindingkinase activitytransferase activityhydrolase activityoxygen bindingenzyme regulator activitycarbohydrate bindingsignaling receptor activitytranslation regulator activitytranscription regulator activityother molecular functionall biological processcarbohydrate metabolic processgeneration of precursor metabolites and energynucleobase-containing compound metabolic processdna metabolic processtranslationlipid metabolic processtransportresponse to stresscell cyclecell communicationsignal transductioncell-cell signalingmulticellular organism developmentcircadian rhythmbiological_processmetabolic processcatabolic processbiosynthetic processresponse to light stimulusresponse to external stimulustropismresponse to biotic stimulusresponse to abiotic stimulusresponse to endogenous stimulusembryo developmentpost-embryonic developmentfruit ripeningabscissionpollinationflower developmentcellular processprogrammed cell deathphotosynthesiscellular component organizationcell growthprotein metabolic processcellular homeostasissecondary metabolic processreproductive processcell differentiationprotein modification processgrowthepigenetic regulation of gene expressionresponse to chemicalanatomical structure developmentregulation of molecular functionother biological processall cellular componentcellular_componentextracellular regioncell wallintracellular anatomical structurenucleusnuclear envelopenucleoplasmnucleoluscytoplasmmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuscytosolribosomecytoskeletonplasma membranechloroplastplastidthylakoidmembraneexternal encapsulating structureother cellular component
Cell color indicative of number of GO terms
AspectTerm
Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
Biological Processcarbohydrate metabolic process

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Glucan endo-1,3-beta-glucosidase GII

Organism names

  • Taxonomic identifier
  • Strain
    • cv. AL8/78
  • Taxonomic lineage
    Eukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Triticinae > Aegilops

Accessions

  • Primary accession
    A0A452XB12

Proteomes

Genome annotation databases

Interaction

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the glycosyl hydrolase 17 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    309
  • Mass (Da)
    32,904
  • Last updated
    2019-05-08 v1
  • Checksum
    066364CEDF3E6DA8
MTIGVCYGVVANNLPPANEVVQLYRSKGLTGMRIYFADAKALSALRGSGIALILDIGGNDVLASLAASASNAANWVRDNVRPYYPAVNIKYIAAGNEILGGDTQNIVPAMRNLNSALNGAGLGAIKVSTSIRFDAVTNTFPPSNGVFAQAYMTDVARLLASTAAPLLANVYPYFAYKDNPRDIQLNYATFRPGTTVRDQNNGLTYTCLFDAMVDAVVAALERAGAPGVRVVVSESGWPSASGFAATADNARAYNQGLIDHVGGGTPKRPGLLETYIFAMFNENFKTGELTEKHFGLFNPDKSPAYPIRF

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp