A0A386AYC0 · A0A386AYC0_9CHLO
- ProteinCytochrome b559 subunit alpha
- GenepsbE
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation.
Cofactor
Note: With its partner (PsbF) binds heme. PSII binds additional chlorophylls, carotenoids and specific lipids.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem II reaction center | |
Molecular Function | electron transfer activity | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Biological Process | photosynthetic electron transport chain |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome b559 subunit alpha
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > Ulvophyceae > TCBD clade > Bryopsidales > Bryopsidineae > Bryopsidaceae > Pseudochlorodesmis
Accessions
- Primary accessionA0A386AYC0
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 20-44 | Helical | ||||
Sequence: WVIHSITIPSLFIAGWLFVSTGLAY |
Keywords
- Cellular component
Interaction
Subunit
Heterodimer of an alpha subunit and a beta subunit. PSII is composed of 1 copy each of membrane proteins PsbA, PsbB, PsbC, PsbD, PsbE, PsbF, PsbH, PsbI, PsbJ, PsbK, PsbL, PsbM, PsbT, PsbX, PsbY, PsbZ, Psb30/Ycf12, at least 3 peripheral proteins of the oxygen-evolving complex and a large number of cofactors. It forms dimeric complexes.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-34 | Photosystem II cytochrome b559 N-terminal | ||||
Sequence: ERPFSDILTSIRYWVIHSITIPSLFIAG | ||||||
Domain | 42-78 | Photosystem II cytochrome b559 alpha subunit lumenal region | ||||
Sequence: LAYDVFGSPRPNEYFTEERQAAPLITDRLNAYEQVQS |
Sequence similarities
Belongs to the PsbE/PsbF family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length80
- Mass (Da)9,087
- Last updated2018-12-05 v1
- Checksum261BFCEEE9CB59DE