A0A2T7EFC6 · A0A2T7EFC6_9POAL
- ProteinCASP-like protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids191 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane |
Names & Taxonomy
Protein names
- Recommended nameCASP-like protein
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > PACMAD clade > Panicoideae > Panicodae > Paniceae > Panicinae > Panicum > Panicum sect. Panicum
Accessions
- Primary accessionA0A2T7EFC6
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 83-99 | Helical | ||||
Sequence: YRYIVAVGLLAFVYTTL | ||||||
Transmembrane | 164-186 | Helical | ||||
Sequence: ISMAFFAFVCLALSAIISGFKLA |
Keywords
- Cellular component
Interaction
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: MADVEKGAPVPAAAPAEGGEAADGGR | ||||||
Domain | 44-173 | Casparian strip membrane protein | ||||
Sequence: LERSGSALRAGAWALSLLAFLVMACNEHGDWKQFDRYEEYRYIVAVGLLAFVYTTLQLLRHAVRLTGGQDLQPKSGLLVDFAGDQVTAYLMMSALSAAIPITNRMREGADNVFTDSSAASISMAFFAFVC |
Sequence similarities
Belongs to the Casparian strip membrane proteins (CASP) family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length191
- Mass (Da)20,368
- Last updated2018-07-18 v1
- Checksum8ECFCF99534ACFFB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM009751 EMBL· GenBank· DDBJ | PUZ66527.1 EMBL· GenBank· DDBJ | Genomic DNA |