A0A2K6QYP2 · A0A2K6QYP2_RHIRO
- ProteinNADPH--cytochrome P450 reductase
- GenePOR
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids602 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
Catalytic activity
- NADPH + 2 oxidized [cytochrome P450] = H+ + NADP+ + 2 reduced [cytochrome P450]
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 FAD per monomer.
Note: Binds 1 FMN per monomer.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 11-16 | FMN (UniProtKB | ChEBI) | ||||
Sequence: SQTGTA | ||||||
Binding site | 63-66 | FMN (UniProtKB | ChEBI) | ||||
Sequence: ATYG | ||||||
Binding site | 98-107 | FMN (UniProtKB | ChEBI) | ||||
Sequence: LGNKTYEHFN | ||||||
Binding site | 133 | FMN (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 223 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 349 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 379-382 | FAD (UniProtKB | ChEBI) | ||||
Sequence: RYYS | ||||||
Binding site | 397-399 | FAD (UniProtKB | ChEBI) | ||||
Sequence: CAV | ||||||
Binding site | 403 | FAD (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 413-416 | FAD (UniProtKB | ChEBI) | ||||
Sequence: GVAT | ||||||
Binding site | 460 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 521-522 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: SR | ||||||
Binding site | 527-531 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: KVYVQ | ||||||
Binding site | 563 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 601 | FAD (UniProtKB | ChEBI) | ||||
Sequence: W |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | FMN binding | |
Molecular Function | NADP binding | |
Molecular Function | NADPH-hemoprotein reductase activity | |
Biological Process | response to hormone |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADPH--cytochrome P450 reductase
- EC number
- Short namesCPR ; P450R
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Colobinae > Rhinopithecus
Accessions
- Primary accessionA0A2K6QYP2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-149 | Flavodoxin-like | ||||
Sequence: IIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFW | ||||||
Domain | 204-446 | FAD-binding FR-type | ||||
Sequence: KNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVIMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHVCAVVVEYETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLP |
Sequence similarities
Belongs to the NADPH--cytochrome P450 reductase family.
In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
In the N-terminal section; belongs to the flavodoxin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length602
- Mass (Da)68,191
- Last updated2018-03-28 v1
- Checksum8DF9F67352474018
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2K6QYM7 | A0A2K6QYM7_RHIRO | POR | 680 | ||
A0A2K6QYQ3 | A0A2K6QYQ3_RHIRO | POR | 364 | ||
A0A2K6QYN1 | A0A2K6QYN1_RHIRO | POR | 326 | ||
A0A2K6QYQ4 | A0A2K6QYQ4_RHIRO | POR | 223 |
Keywords
- Technical term