A0A2G5CL64 · A0A2G5CL64_AQUCA
- ProteinL-ascorbate peroxidase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids246 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Cofactor
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | heme binding | |
Molecular Function | L-ascorbate peroxidase activity | |
Molecular Function | metal ion binding | |
Biological Process | cellular response to oxidative stress | |
Biological Process | hydrogen peroxide catabolic process | |
Biological Process | response to reactive oxygen species |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameL-ascorbate peroxidase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Ranunculales > Ranunculaceae > Thalictroideae > Aquilegia
Accessions
- Primary accessionA0A2G5CL64
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 74-246 | Plant heme peroxidase family profile | ||||
Sequence: LDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWTANPLIFDNSYFKELLSGEKEGLLQLPSDKALLADPSFRPLVEKYAADEDAFFEDYAEAHLKLSELG | ||||||
Region | 113-137 | Disordered | ||||
Sequence: VPFHPGRQDKPEPPPEGRLPDATKG | ||||||
Compositional bias | 117-137 | Basic and acidic residues | ||||
Sequence: PGRQDKPEPPPEGRLPDATKG |
Sequence similarities
Belongs to the peroxidase family. Ascorbate peroxidase subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length246
- Mass (Da)27,054
- Last updated2018-01-31 v1
- Checksum8D606D2DFF9DA408
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2G5CLB3 | A0A2G5CLB3_AQUCA | AQUCO_04600020v1 | 250 | ||
A0A2G5CLA0 | A0A2G5CLA0_AQUCA | AQUCO_04600020v1 | 237 | ||
A0A2G5CLE3 | A0A2G5CLE3_AQUCA | AQUCO_04600020v1 | 192 | ||
A0A2G5CLJ1 | A0A2G5CLJ1_AQUCA | AQUCO_04600020v1 | 137 | ||
A0A2G5CL94 | A0A2G5CL94_AQUCA | AQUCO_04600020v1 | 248 | ||
A0A2G5CMJ3 | A0A2G5CMJ3_AQUCA | AQUCO_04600020v1 | 198 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 117-137 | Basic and acidic residues | ||||
Sequence: PGRQDKPEPPPEGRLPDATKG |
Keywords
- Technical term