A0A2D4L2U3 · A0A2D4L2U3_9SAUR
- ProteinPID domain-containing protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids277 (go to sequence)
- Protein existencePredicted
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ruffle membrane | |
Cellular Component | vesicle | |
Molecular Function | actin binding | |
Biological Process | positive regulation of ruffle assembly | |
Biological Process | regulation of Rho protein signal transduction | |
Biological Process | Rho protein signal transduction |
Names & Taxonomy
Protein names
- Recommended namePID domain-containing protein
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Sauropsida (sauropsids) > Sauria (diapsids) > Lepidosauria (lepidosaurs) > Squamata (squamates) > Bifurcata (split-tongued squamates) > Unidentata > Episquamata > Toxicofera > Serpentes (snakes) > Colubroidea > Elapidae > Elapinae > Micrurus (coral snakes)
Accessions
- Primary accessionA0A2D4L2U3
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: HTLDARGSSPRKGVSEQRKKYS | ||||||
Domain | 29-166 | PID | ||||
Sequence: HETSQYHVQHLATFIMDKSEAIVTVEDAVRKLKQLNSKEKIWAQEMLLQVNDKSIRLLDCGTQEELEDFLLPTVQHCQTVLNQMRYPSILLLVCQDSEQHKPDIHFFNCDEVEAEMVHEDIESALADHKFGKKIRPQT | ||||||
Region | 174-224 | Disordered | ||||
Sequence: IKQRQSILPPPQGPAPIPFHDESRSFRKNNQNRVVPLSQPEYDRRSSSQDY | ||||||
Compositional bias | 202-217 | Polar residues | ||||
Sequence: NNQNRVVPLSQPEYDR |
Family and domain databases
Sequence
- Sequence statusFragment
- Length277
- Mass (Da)32,067
- Last updated2018-01-31 v1
- ChecksumD5F5936F131BBF91
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: H | ||||||
Compositional bias | 202-217 | Polar residues | ||||
Sequence: NNQNRVVPLSQPEYDR | ||||||
Non-terminal residue | 277 | |||||
Sequence: K |