A0A219CM62 · BMN7O_BOMOR
- ProteinBombinins BLP-7/H-BO
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids141 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Bombinin-like peptide 7
Antimicrobial peptide with activity against Gram-positive and -negative bacteria and fungi (PubMed:22439858, PubMed:32540219).
Shows activity against P.acnes (MIC=5 uM), E.coli (MIC=5-6.3 uM), S.aureus (MIC=5-6.3 uM), M.luteus, S.cerevisiae and C.albicans (MIC=10-12.5 uM) (PubMed:22439858, PubMed:28636781, PubMed:32540219).
Also reduces the production of interleukin (IL)-8 and granulocyte-macrophage colony stimulating factor (CSF2) in normal human epidermal keratinocytes (NHEKs) (PubMed:32540219).
Shows anticancer activity against three human hepatoma cell lines (PubMed:28636781).
In vivo, using the rat ear edema model, suppress P.acnes-induced skin inflammation, significantly reducing the ear thickness (PubMed:32540219).
Shows weak hemolytic activity against human erythrocytes (PubMed:28636781).
Shows activity against P.acnes (MIC=5 uM), E.coli (MIC=5-6.3 uM), S.aureus (MIC=5-6.3 uM), M.luteus, S.cerevisiae and C.albicans (MIC=10-12.5 uM) (PubMed:22439858, PubMed:28636781, PubMed:32540219).
Also reduces the production of interleukin (IL)-8 and granulocyte-macrophage colony stimulating factor (CSF2) in normal human epidermal keratinocytes (NHEKs) (PubMed:32540219).
Shows anticancer activity against three human hepatoma cell lines (PubMed:28636781).
In vivo, using the rat ear edema model, suppress P.acnes-induced skin inflammation, significantly reducing the ear thickness (PubMed:32540219).
Shows weak hemolytic activity against human erythrocytes (PubMed:28636781).
Bombinin H-BO
Shows weak antimicrobial activity (tested on E.coli, S.aureus and C.albicans) (PubMed:28636781).
Shows high hemolytic activity against human erythrocytes (38% erythrocyte lysis at 80.0 uM, and up to 85% at 159.7 uM) (PubMed:28636781).
Shows high hemolytic activity against human erythrocytes (38% erythrocyte lysis at 80.0 uM, and up to 85% at 159.7 uM) (PubMed:28636781).
Miscellaneous
BLP-7 is also encoded by another gene from the same species (AC Q9DET7).
pH Dependence
Stable from pH 3.0 to 12.0.
Temperature Dependence
Highly thermostable, when continuously exposed at the temperatures ranging from 20 to 100 degrees Celsius for 30 minutes.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | defense response to bacterium | |
Biological Process | defense response to fungus | |
Biological Process | killing of cells of another organism |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameBombinins BLP-7/H-BO
- Cleaved into 2 chains
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Bombinatoridae > Bombina
Accessions
- Primary accessionA0A219CM62
Subcellular Location
Phenotypes & Variants
Pharmaceutical
Bombinin-like peptide 7
Could be used as a potential agent in the treatment against acne, since it shows antibacterial activity against P.acnes and it both reduces the production of pro-inflammatory cytokines and the skin inflammation induced by P.acnes in rat ear edema model.
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MNFKYIIAVSFLIASTYA | ||||||
Propeptide | PRO_0000451085 | 19-43 | ||||
Sequence: RSVKNDEQSLSQRDVLDEESLREIR | ||||||
Peptide | PRO_5011967929 | 44-70 | Bombinin-like peptide 7 | |||
Sequence: GIGGALLSAGKSALKGLAKGLAEHFAN | ||||||
Modified residue | 70 | Asparagine amide | ||||
Sequence: N | ||||||
Propeptide | PRO_0000451086 | 74-123 | ||||
Sequence: TAEEHEVMKRLEAVMRDLDSLDHPEEASEKETRGFNQEEIANLFTKKEKR | ||||||
Peptide | PRO_0000451087 | 124-140 | Bombinin H-BO | |||
Sequence: IIGPVLGLIGKALGGLL | ||||||
Modified residue | 140 | Leucine amide | ||||
Sequence: L |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the skin glands.
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length141
- Mass (Da)15,454
- Last updated2017-09-27 v1
- Checksum22421C38556AB39C
Mass Spectrometry
Bombinin-like peptide 7
Molecular mass is 2,551.01 Da. Determined by Electrospray.Bombinin H-BO
Molecular mass is 1,603.08 Da. Determined by Electrospray.Keywords
- Technical term