A0A1P8SJH9 · A0A1P8SJH9_9LAMI
- ProteinCathepsin B
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids
- Protein existenceInferred from homology
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | lysosome | |
Molecular Function | cysteine-type endopeptidase activity | |
Biological Process | proteolysis involved in protein catabolic process |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Lamiales > Acanthaceae > Avicennioideae > Avicennia
Accessions
- Primary accessionA0A1P8SJH9
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-65 | Peptidase C1A papain C-terminal | ||||
Sequence: GPVEVSFTVYEDFAHYKSGVYKHITGDEMGGHAVKLIGWGTTDDGEDYWLLANQWNRSWGDDGYF |
Sequence similarities
Belongs to the peptidase C1 family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length66
- Mass (Da)7,521
- Last updated2017-04-12 v1
- Checksum53F9B5417CB6AF3C
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: G | ||||||
Non-terminal residue | 66 | |||||
Sequence: M |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KX240412 EMBL· GenBank· DDBJ | APY22413.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240413 EMBL· GenBank· DDBJ | APY22414.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240414 EMBL· GenBank· DDBJ | APY22415.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240415 EMBL· GenBank· DDBJ | APY22416.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240416 EMBL· GenBank· DDBJ | APY22417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240417 EMBL· GenBank· DDBJ | APY22418.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240418 EMBL· GenBank· DDBJ | APY22419.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240419 EMBL· GenBank· DDBJ | APY22420.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240420 EMBL· GenBank· DDBJ | APY22421.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240421 EMBL· GenBank· DDBJ | APY22422.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240422 EMBL· GenBank· DDBJ | APY22423.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240423 EMBL· GenBank· DDBJ | APY22424.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240424 EMBL· GenBank· DDBJ | APY22425.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240425 EMBL· GenBank· DDBJ | APY22426.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240426 EMBL· GenBank· DDBJ | APY22427.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240427 EMBL· GenBank· DDBJ | APY22428.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240428 EMBL· GenBank· DDBJ | APY22429.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240429 EMBL· GenBank· DDBJ | APY22430.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240430 EMBL· GenBank· DDBJ | APY22431.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240431 EMBL· GenBank· DDBJ | APY22432.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240432 EMBL· GenBank· DDBJ | APY22433.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240433 EMBL· GenBank· DDBJ | APY22434.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240434 EMBL· GenBank· DDBJ | APY22435.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240435 EMBL· GenBank· DDBJ | APY22436.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KX240436 EMBL· GenBank· DDBJ | APY22437.1 EMBL· GenBank· DDBJ | Genomic DNA |